Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37839_RS05910 | Genome accession | NZ_CP151453 |
| Coordinates | 1169097..1169279 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37839 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169097..1204107 | 1169097..1169279 | within | 0 |
Gene organization within MGE regions
Location: 1169097..1204107
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37839_RS05910 (MGAS37839_02436) | prx | 1169097..1169279 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37839_RS05915 (MGAS37839_02438) | sda3 | 1169518..1170318 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37839_RS05920 (MGAS37839_02440) | - | 1170589..1171023 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37839_RS05925 (MGAS37839_02442) | - | 1171093..1172298 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37839_RS05930 (MGAS37839_02444) | - | 1172414..1172641 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37839_RS05935 (MGAS37839_02446) | - | 1172638..1172913 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37839_RS05940 (MGAS37839_02448) | - | 1172923..1173540 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37839_RS05945 (MGAS37839_02450) | - | 1173537..1173974 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37839_RS05950 (MGAS37839_02452) | - | 1173986..1175854 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37839_RS05955 (MGAS37839_02454) | - | 1175851..1176546 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37839_RS05960 (MGAS37839_02456) | - | 1176543..1178900 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37839_RS05965 (MGAS37839_02458) | - | 1178900..1179271 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37839_RS05970 (MGAS37839_02460) | - | 1179286..1179549 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37839_RS05975 (MGAS37839_02462) | - | 1179560..1180153 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37839_RS05980 (MGAS37839_02464) | - | 1180165..1180500 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37839_RS05985 (MGAS37839_02466) | - | 1180501..1180737 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37839_RS05990 (MGAS37839_02468) | - | 1180730..1181068 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37839_RS05995 (MGAS37839_02470) | - | 1181028..1181450 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37839_RS06000 (MGAS37839_02472) | - | 1181460..1181660 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37839_RS06005 (MGAS37839_02474) | - | 1181660..1182571 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37839_RS06010 (MGAS37839_02476) | - | 1182596..1183057 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37839_RS06015 (MGAS37839_02478) | - | 1183138..1184553 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37839_RS06020 (MGAS37839_02480) | - | 1184663..1184929 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37839_RS06025 (MGAS37839_02482) | - | 1184922..1185101 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37839_RS06030 (MGAS37839_02484) | - | 1185151..1185375 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37839_RS06035 (MGAS37839_02486) | - | 1185381..1186874 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37839_RS06040 (MGAS37839_02488) | - | 1186867..1188135 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37839_RS06045 (MGAS37839_02490) | - | 1188132..1188488 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37839_RS06050 | - | 1188637..1188981 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37839_RS06055 (MGAS37839_02492) | - | 1189090..1189509 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37839_RS06060 (MGAS37839_02494) | - | 1189777..1190412 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37839_RS06065 (MGAS37839_02496) | - | 1190414..1190683 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37839_RS06070 (MGAS37839_02498) | - | 1190767..1191279 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37839_RS06075 (MGAS37839_02500) | - | 1191276..1191617 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37839_RS06080 (MGAS37839_02502) | - | 1191795..1191962 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37839_RS06085 (MGAS37839_02504) | - | 1191972..1192769 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37839_RS06090 (MGAS37839_02506) | - | 1192766..1193695 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37839_RS06095 (MGAS37839_02508) | - | 1193698..1194027 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37839_RS06100 (MGAS37839_02510) | - | 1194083..1194289 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37839_RS06105 (MGAS37839_02512) | - | 1194298..1194438 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37839_RS06110 (MGAS37839_02514) | - | 1194435..1194668 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37839_RS06115 (MGAS37839_02516) | - | 1194649..1195038 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37839_RS06120 (MGAS37839_02518) | - | 1195183..1195422 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37839_RS06125 (MGAS37839_02520) | - | 1195522..1195707 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37839_RS06130 (MGAS37839_02522) | - | 1195709..1196020 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37839_RS06135 (MGAS37839_02524) | - | 1196098..1196283 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37839_RS06140 (MGAS37839_02526) | - | 1196450..1196689 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37839_RS06145 (MGAS37839_02528) | - | 1196831..1197637 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37839_RS06150 (MGAS37839_02530) | - | 1197572..1197838 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37839_RS06155 (MGAS37839_02532) | - | 1197870..1198586 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37839_RS06160 (MGAS37839_02534) | - | 1198598..1198789 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37839_RS06165 | - | 1199425..1199520 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37839_RS06170 (MGAS37839_02538) | - | 1199943..1200290 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37839_RS06175 (MGAS37839_02540) | - | 1200294..1200674 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37839_RS06180 (MGAS37839_02542) | - | 1200686..1200952 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37839_RS06185 (MGAS37839_02544) | - | 1201076..1202218 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37839_RS06190 (MGAS37839_02546) | - | 1202308..1202583 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37839_RS06195 (MGAS37839_02548) | - | 1202682..1203269 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37839_RS06200 (MGAS37839_02550) | - | 1203247..1204089 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977661 MGAS37839_RS05910 WP_011017964.1 1169097..1169279(-) (prx) [Streptococcus pyogenes strain MGAS37839]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977661 MGAS37839_RS05910 WP_011017964.1 1169097..1169279(-) (prx) [Streptococcus pyogenes strain MGAS37839]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |