Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37843_RS05910 | Genome accession | NZ_CP151451 |
| Coordinates | 1169098..1169280 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37843 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169098..1204108 | 1169098..1169280 | within | 0 |
Gene organization within MGE regions
Location: 1169098..1204108
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37843_RS05910 (MGAS37843_02434) | prx | 1169098..1169280 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37843_RS05915 (MGAS37843_02436) | sda3 | 1169519..1170319 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37843_RS05920 (MGAS37843_02438) | - | 1170590..1171024 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37843_RS05925 (MGAS37843_02440) | - | 1171094..1172299 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37843_RS05930 (MGAS37843_02442) | - | 1172415..1172642 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37843_RS05935 (MGAS37843_02444) | - | 1172639..1172914 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37843_RS05940 (MGAS37843_02446) | - | 1172924..1173541 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37843_RS05945 (MGAS37843_02448) | - | 1173538..1173975 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37843_RS05950 (MGAS37843_02450) | - | 1173987..1175855 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37843_RS05955 (MGAS37843_02452) | - | 1175852..1176547 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37843_RS05960 (MGAS37843_02454) | - | 1176544..1178901 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37843_RS05965 (MGAS37843_02456) | - | 1178901..1179272 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37843_RS05970 (MGAS37843_02458) | - | 1179287..1179550 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37843_RS05975 (MGAS37843_02460) | - | 1179561..1180154 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37843_RS05980 (MGAS37843_02462) | - | 1180166..1180501 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37843_RS05985 (MGAS37843_02464) | - | 1180502..1180738 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37843_RS05990 (MGAS37843_02466) | - | 1180731..1181069 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37843_RS05995 (MGAS37843_02468) | - | 1181029..1181451 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37843_RS06000 (MGAS37843_02470) | - | 1181461..1181661 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37843_RS06005 (MGAS37843_02472) | - | 1181661..1182572 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37843_RS06010 (MGAS37843_02474) | - | 1182597..1183058 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37843_RS06015 (MGAS37843_02476) | - | 1183139..1184554 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37843_RS06020 (MGAS37843_02478) | - | 1184664..1184930 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37843_RS06025 (MGAS37843_02480) | - | 1184923..1185102 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37843_RS06030 (MGAS37843_02482) | - | 1185152..1185376 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37843_RS06035 (MGAS37843_02484) | - | 1185382..1186875 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37843_RS06040 (MGAS37843_02486) | - | 1186868..1188136 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37843_RS06045 (MGAS37843_02488) | - | 1188133..1188489 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37843_RS06050 | - | 1188638..1188982 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37843_RS06055 (MGAS37843_02490) | - | 1189091..1189510 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37843_RS06060 (MGAS37843_02492) | - | 1189778..1190413 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37843_RS06065 (MGAS37843_02494) | - | 1190415..1190684 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37843_RS06070 (MGAS37843_02496) | - | 1190768..1191280 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37843_RS06075 (MGAS37843_02498) | - | 1191277..1191618 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37843_RS06080 (MGAS37843_02500) | - | 1191796..1191963 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37843_RS06085 (MGAS37843_02502) | - | 1191973..1192770 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37843_RS06090 (MGAS37843_02504) | - | 1192767..1193696 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37843_RS06095 (MGAS37843_02506) | - | 1193699..1194028 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37843_RS06100 (MGAS37843_02508) | - | 1194084..1194290 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37843_RS06105 (MGAS37843_02510) | - | 1194299..1194439 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37843_RS06110 (MGAS37843_02512) | - | 1194436..1194669 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37843_RS06115 (MGAS37843_02514) | - | 1194650..1195039 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37843_RS06120 (MGAS37843_02516) | - | 1195184..1195423 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37843_RS06125 (MGAS37843_02518) | - | 1195523..1195708 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37843_RS06130 (MGAS37843_02520) | - | 1195710..1196021 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37843_RS06135 (MGAS37843_02522) | - | 1196099..1196284 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37843_RS06140 (MGAS37843_02524) | - | 1196451..1196690 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37843_RS06145 (MGAS37843_02526) | - | 1196832..1197638 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37843_RS06150 (MGAS37843_02528) | - | 1197573..1197839 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37843_RS06155 (MGAS37843_02530) | - | 1197871..1198587 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37843_RS06160 (MGAS37843_02532) | - | 1198599..1198790 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37843_RS06165 | - | 1199426..1199521 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37843_RS06170 (MGAS37843_02536) | - | 1199944..1200291 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37843_RS06175 (MGAS37843_02538) | - | 1200295..1200675 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37843_RS06180 (MGAS37843_02540) | - | 1200687..1200953 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37843_RS06185 (MGAS37843_02542) | - | 1201077..1202219 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37843_RS06190 (MGAS37843_02544) | - | 1202309..1202584 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37843_RS06195 (MGAS37843_02546) | - | 1202683..1203270 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37843_RS06200 (MGAS37843_02548) | - | 1203248..1204090 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977549 MGAS37843_RS05910 WP_011017964.1 1169098..1169280(-) (prx) [Streptococcus pyogenes strain MGAS37843]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977549 MGAS37843_RS05910 WP_011017964.1 1169098..1169280(-) (prx) [Streptococcus pyogenes strain MGAS37843]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |