Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37844_RS07180 | Genome accession | NZ_CP151450 |
| Coordinates | 1408804..1408983 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37844 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408804..1449420 | 1408804..1408983 | within | 0 |
Gene organization within MGE regions
Location: 1408804..1449420
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37844_RS07180 (MGAS37844_02946) | prx | 1408804..1408983 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37844_RS07185 (MGAS37844_02948) | sda1 | 1409222..1410394 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37844_RS07190 (MGAS37844_02950) | - | 1410510..1411706 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37844_RS07195 (MGAS37844_02954) | - | 1411817..1412002 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37844_RS07200 (MGAS37844_02956) | - | 1411999..1412298 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37844_RS07205 (MGAS37844_02958) | - | 1412309..1412929 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37844_RS07210 (MGAS37844_02960) | - | 1412932..1413093 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37844_RS07215 (MGAS37844_02962) | - | 1413102..1415009 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37844_RS07220 (MGAS37844_02964) | - | 1415020..1415655 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37844_RS07225 (MGAS37844_02966) | - | 1415655..1416710 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37844_RS07230 (MGAS37844_02968) | - | 1416707..1418689 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37844_RS07235 (MGAS37844_02970) | - | 1418699..1419541 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37844_RS07240 (MGAS37844_02972) | - | 1419553..1423935 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37844_RS07245 (MGAS37844_02974) | - | 1423950..1424183 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37844_RS07250 (MGAS37844_02976) | - | 1424258..1424713 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37844_RS07255 (MGAS37844_02978) | - | 1424767..1425366 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37844_RS07260 (MGAS37844_02980) | - | 1425378..1425737 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37844_RS07265 (MGAS37844_02982) | - | 1425741..1426085 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37844_RS07270 (MGAS37844_02984) | - | 1426082..1426360 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37844_RS07275 (MGAS37844_02986) | - | 1426371..1426727 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37844_RS07280 (MGAS37844_02988) | - | 1426739..1427626 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37844_RS07285 (MGAS37844_02990) | - | 1427639..1428208 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37844_RS07290 (MGAS37844_02992) | - | 1428364..1428630 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37844_RS07295 | - | 1428633..1428821 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37844_RS07300 (MGAS37844_02996) | - | 1428852..1430297 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37844_RS07305 (MGAS37844_02998) | - | 1430257..1431789 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS37844_RS07310 (MGAS37844_03000) | - | 1431805..1433082 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37844_RS07315 (MGAS37844_03002) | - | 1433072..1433524 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37844_RS07320 (MGAS37844_03004) | - | 1433614..1434030 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37844_RS07325 (MGAS37844_03006) | - | 1434027..1434218 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37844_RS07330 (MGAS37844_03008) | - | 1434208..1435059 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS37844_RS07335 (MGAS37844_03010) | - | 1435068..1435334 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37844_RS07340 (MGAS37844_03012) | - | 1435331..1435498 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37844_RS07345 (MGAS37844_03014) | - | 1435499..1436821 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37844_RS07350 (MGAS37844_03016) | - | 1436818..1437093 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37844_RS07355 (MGAS37844_03018) | - | 1437480..1439864 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37844_RS07360 (MGAS37844_03020) | - | 1439869..1441791 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37844_RS07365 (MGAS37844_03022) | - | 1441834..1442391 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37844_RS07370 (MGAS37844_03024) | - | 1442402..1442800 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37844_RS07375 (MGAS37844_03026) | - | 1442804..1443958 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37844_RS07380 (MGAS37844_03028) | - | 1443958..1444257 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37844_RS07385 (MGAS37844_03030) | - | 1444345..1444548 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37844_RS07390 (MGAS37844_03034) | - | 1444694..1445080 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37844_RS07395 (MGAS37844_03036) | - | 1445077..1445280 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37844_RS07400 (MGAS37844_03038) | - | 1445273..1445443 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37844_RS07405 (MGAS37844_03040) | - | 1445440..1445715 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37844_RS07410 (MGAS37844_03042) | - | 1445777..1445992 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37844_RS07415 (MGAS37844_03044) | - | 1446040..1446453 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37844_RS07420 (MGAS37844_03046) | - | 1446434..1446589 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37844_RS07425 (MGAS37844_03048) | - | 1446915..1447265 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37844_RS07430 (MGAS37844_03050) | - | 1447279..1447662 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37844_RS07435 (MGAS37844_03052) | - | 1447673..1448224 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37844_RS07440 (MGAS37844_03054) | - | 1448341..1449420 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=977500 MGAS37844_RS07180 WP_002988813.1 1408804..1408983(-) (prx) [Streptococcus pyogenes strain MGAS37844]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=977500 MGAS37844_RS07180 WP_002988813.1 1408804..1408983(-) (prx) [Streptococcus pyogenes strain MGAS37844]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |