Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37847_RS05910 | Genome accession | NZ_CP151449 |
| Coordinates | 1169118..1169300 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37847 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169118..1204128 | 1169118..1169300 | within | 0 |
Gene organization within MGE regions
Location: 1169118..1204128
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37847_RS05910 (MGAS37847_02430) | prx | 1169118..1169300 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37847_RS05915 (MGAS37847_02432) | sda3 | 1169539..1170339 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37847_RS05920 (MGAS37847_02434) | - | 1170610..1171044 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37847_RS05925 (MGAS37847_02436) | - | 1171114..1172319 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37847_RS05930 (MGAS37847_02438) | - | 1172435..1172662 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37847_RS05935 (MGAS37847_02440) | - | 1172659..1172934 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37847_RS05940 (MGAS37847_02442) | - | 1172944..1173561 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37847_RS05945 (MGAS37847_02444) | - | 1173558..1173995 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37847_RS05950 (MGAS37847_02446) | - | 1174007..1175875 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37847_RS05955 (MGAS37847_02448) | - | 1175872..1176567 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37847_RS05960 (MGAS37847_02450) | - | 1176564..1178921 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37847_RS05965 (MGAS37847_02452) | - | 1178921..1179292 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37847_RS05970 (MGAS37847_02454) | - | 1179307..1179570 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37847_RS05975 (MGAS37847_02456) | - | 1179581..1180174 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37847_RS05980 (MGAS37847_02458) | - | 1180186..1180521 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37847_RS05985 (MGAS37847_02460) | - | 1180522..1180758 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37847_RS05990 (MGAS37847_02462) | - | 1180751..1181089 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37847_RS05995 (MGAS37847_02464) | - | 1181049..1181471 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37847_RS06000 (MGAS37847_02466) | - | 1181481..1181681 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37847_RS06005 (MGAS37847_02468) | - | 1181681..1182592 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37847_RS06010 (MGAS37847_02470) | - | 1182617..1183078 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37847_RS06015 (MGAS37847_02472) | - | 1183159..1184574 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37847_RS06020 (MGAS37847_02474) | - | 1184684..1184950 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37847_RS06025 (MGAS37847_02476) | - | 1184943..1185122 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37847_RS06030 (MGAS37847_02478) | - | 1185172..1185396 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37847_RS06035 (MGAS37847_02480) | - | 1185402..1186895 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37847_RS06040 (MGAS37847_02482) | - | 1186888..1188156 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37847_RS06045 (MGAS37847_02484) | - | 1188153..1188509 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37847_RS06050 | - | 1188658..1189002 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37847_RS06055 (MGAS37847_02486) | - | 1189111..1189530 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37847_RS06060 (MGAS37847_02488) | - | 1189798..1190433 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37847_RS06065 (MGAS37847_02490) | - | 1190435..1190704 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37847_RS06070 (MGAS37847_02492) | - | 1190788..1191300 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37847_RS06075 (MGAS37847_02494) | - | 1191297..1191638 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37847_RS06080 (MGAS37847_02496) | - | 1191816..1191983 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37847_RS06085 (MGAS37847_02498) | - | 1191993..1192790 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37847_RS06090 (MGAS37847_02500) | - | 1192787..1193716 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37847_RS06095 (MGAS37847_02502) | - | 1193719..1194048 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37847_RS06100 (MGAS37847_02504) | - | 1194104..1194310 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37847_RS06105 (MGAS37847_02506) | - | 1194319..1194459 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37847_RS06110 (MGAS37847_02508) | - | 1194456..1194689 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37847_RS06115 (MGAS37847_02510) | - | 1194670..1195059 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37847_RS06120 | - | 1195204..1195443 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37847_RS06125 (MGAS37847_02512) | - | 1195543..1195728 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37847_RS06130 (MGAS37847_02514) | - | 1195730..1196041 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37847_RS06135 (MGAS37847_02516) | - | 1196119..1196304 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37847_RS06140 (MGAS37847_02518) | - | 1196471..1196710 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37847_RS06145 (MGAS37847_02520) | - | 1196852..1197658 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37847_RS06150 (MGAS37847_02522) | - | 1197593..1197859 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37847_RS06155 (MGAS37847_02524) | - | 1197891..1198607 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37847_RS06160 (MGAS37847_02526) | - | 1198619..1198810 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37847_RS06165 | - | 1199446..1199541 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37847_RS06170 (MGAS37847_02530) | - | 1199964..1200311 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37847_RS06175 (MGAS37847_02532) | - | 1200315..1200695 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37847_RS06180 (MGAS37847_02534) | - | 1200707..1200973 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37847_RS06185 (MGAS37847_02536) | - | 1201097..1202239 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37847_RS06190 (MGAS37847_02538) | - | 1202329..1202604 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37847_RS06195 (MGAS37847_02540) | - | 1202703..1203290 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37847_RS06200 (MGAS37847_02542) | - | 1203268..1204110 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977437 MGAS37847_RS05910 WP_011017964.1 1169118..1169300(-) (prx) [Streptococcus pyogenes strain MGAS37847]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977437 MGAS37847_RS05910 WP_011017964.1 1169118..1169300(-) (prx) [Streptococcus pyogenes strain MGAS37847]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |