Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37848_RS05910 | Genome accession | NZ_CP151448 |
| Coordinates | 1169096..1169278 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37848 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169096..1204105 | 1169096..1169278 | within | 0 |
Gene organization within MGE regions
Location: 1169096..1204105
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37848_RS05910 (MGAS37848_02434) | prx | 1169096..1169278 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37848_RS05915 (MGAS37848_02436) | sda3 | 1169517..1170317 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37848_RS05920 (MGAS37848_02438) | - | 1170588..1171022 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37848_RS05925 (MGAS37848_02440) | - | 1171092..1172297 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37848_RS05930 (MGAS37848_02442) | - | 1172413..1172640 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37848_RS05935 (MGAS37848_02444) | - | 1172637..1172912 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37848_RS05940 (MGAS37848_02446) | - | 1172922..1173539 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37848_RS05945 (MGAS37848_02448) | - | 1173536..1173973 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37848_RS05950 (MGAS37848_02450) | - | 1173985..1175853 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37848_RS05955 (MGAS37848_02452) | - | 1175850..1176545 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37848_RS05960 (MGAS37848_02454) | - | 1176542..1178899 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37848_RS05965 (MGAS37848_02456) | - | 1178899..1179270 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37848_RS05970 (MGAS37848_02458) | - | 1179285..1179548 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37848_RS05975 (MGAS37848_02460) | - | 1179559..1180152 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37848_RS05980 (MGAS37848_02462) | - | 1180164..1180499 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37848_RS05985 (MGAS37848_02464) | - | 1180500..1180736 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37848_RS05990 (MGAS37848_02466) | - | 1180729..1181067 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37848_RS05995 (MGAS37848_02468) | - | 1181027..1181449 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37848_RS06000 (MGAS37848_02470) | - | 1181459..1181659 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37848_RS06005 (MGAS37848_02472) | - | 1181659..1182570 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37848_RS06010 (MGAS37848_02474) | - | 1182595..1183056 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37848_RS06015 (MGAS37848_02476) | - | 1183137..1184552 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37848_RS06020 (MGAS37848_02478) | - | 1184662..1184928 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37848_RS06025 (MGAS37848_02480) | - | 1184921..1185100 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37848_RS06030 (MGAS37848_02482) | - | 1185150..1185374 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37848_RS06035 (MGAS37848_02484) | - | 1185380..1186873 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37848_RS06040 (MGAS37848_02486) | - | 1186866..1188134 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37848_RS06045 (MGAS37848_02488) | - | 1188131..1188486 (-) | 356 | Protein_1144 | hypothetical protein | - |
| MGAS37848_RS06050 | - | 1188635..1188979 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37848_RS06055 (MGAS37848_02490) | - | 1189088..1189507 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37848_RS06060 (MGAS37848_02492) | - | 1189775..1190410 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37848_RS06065 (MGAS37848_02494) | - | 1190412..1190681 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37848_RS06070 (MGAS37848_02496) | - | 1190765..1191277 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37848_RS06075 (MGAS37848_02498) | - | 1191274..1191615 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37848_RS06080 (MGAS37848_02500) | - | 1191793..1191960 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37848_RS06085 (MGAS37848_02502) | - | 1191970..1192767 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37848_RS06090 (MGAS37848_02504) | - | 1192764..1193693 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37848_RS06095 (MGAS37848_02506) | - | 1193696..1194025 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37848_RS06100 (MGAS37848_02508) | - | 1194081..1194287 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37848_RS06105 (MGAS37848_02510) | - | 1194296..1194436 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37848_RS06110 (MGAS37848_02512) | - | 1194433..1194666 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37848_RS06115 (MGAS37848_02514) | - | 1194647..1195036 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37848_RS06120 | - | 1195181..1195420 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37848_RS06125 (MGAS37848_02516) | - | 1195520..1195705 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37848_RS06130 (MGAS37848_02518) | - | 1195707..1196018 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37848_RS06135 (MGAS37848_02520) | - | 1196096..1196281 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37848_RS06140 (MGAS37848_02522) | - | 1196448..1196687 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37848_RS06145 (MGAS37848_02524) | - | 1196829..1197635 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37848_RS06150 (MGAS37848_02526) | - | 1197570..1197836 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37848_RS06155 (MGAS37848_02528) | - | 1197868..1198584 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37848_RS06160 (MGAS37848_02530) | - | 1198596..1198787 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37848_RS06165 | - | 1199423..1199518 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37848_RS06170 (MGAS37848_02534) | - | 1199941..1200288 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37848_RS06175 (MGAS37848_02536) | - | 1200292..1200672 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37848_RS06180 (MGAS37848_02538) | - | 1200684..1200950 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37848_RS06185 (MGAS37848_02540) | - | 1201074..1202216 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37848_RS06190 (MGAS37848_02542) | - | 1202306..1202581 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37848_RS06195 (MGAS37848_02544) | - | 1202680..1203267 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37848_RS06200 (MGAS37848_02546) | - | 1203245..1204087 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977381 MGAS37848_RS05910 WP_011017964.1 1169096..1169278(-) (prx) [Streptococcus pyogenes strain MGAS37848]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977381 MGAS37848_RS05910 WP_011017964.1 1169096..1169278(-) (prx) [Streptococcus pyogenes strain MGAS37848]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |