Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37849_RS05065 | Genome accession | NZ_CP151447 |
| Coordinates | 1007377..1007565 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37849 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999793..1046103 | 1007377..1007565 | within | 0 |
Gene organization within MGE regions
Location: 999793..1046103
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37849_RS05030 (MGAS37849_02070) | pfkA | 999793..1000806 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37849_RS05035 (MGAS37849_02072) | - | 1000886..1003996 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37849_RS05040 (MGAS37849_02074) | - | 1004181..1004552 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37849_RS05045 (MGAS37849_02076) | - | 1004552..1005250 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37849_RS05050 (MGAS37849_02078) | - | 1005260..1006045 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37849_RS05055 (MGAS37849_02080) | - | 1006172..1006786 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37849_RS05065 (MGAS37849_02084) | prx | 1007377..1007565 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37849_RS05070 (MGAS37849_02086) | speA | 1007785..1008540 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37849_RS05075 (MGAS37849_02088) | - | 1008662..1009321 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37849_RS05080 (MGAS37849_02090) | - | 1009321..1009542 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37849_RS05085 (MGAS37849_02092) | - | 1009552..1010325 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37849_RS05090 (MGAS37849_02094) | - | 1010336..1010938 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37849_RS05095 (MGAS37849_02096) | - | 1010950..1011714 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37849_RS05100 (MGAS37849_02098) | - | 1011716..1012048 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37849_RS05105 (MGAS37849_02100) | - | 1012048..1012371 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37849_RS05110 (MGAS37849_02102) | - | 1012385..1012507 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37849_RS05115 (MGAS37849_02104) | - | 1012521..1012868 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37849_RS05120 (MGAS37849_02106) | - | 1012879..1014741 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37849_RS05125 (MGAS37849_02108) | - | 1014746..1018186 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37849_RS05130 (MGAS37849_02110) | - | 1018187..1019671 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37849_RS05135 (MGAS37849_02112) | - | 1019672..1021477 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37849_RS05140 (MGAS37849_02114) | - | 1021470..1021928 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37849_RS05145 (MGAS37849_02116) | - | 1021901..1022218 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37849_RS05150 (MGAS37849_02118) | - | 1022231..1022737 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37849_RS05155 (MGAS37849_02120) | - | 1022749..1023159 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37849_RS05160 (MGAS37849_02122) | - | 1023161..1023556 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37849_RS05165 (MGAS37849_02124) | - | 1023553..1023864 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37849_RS05170 (MGAS37849_02126) | - | 1023861..1024205 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37849_RS05175 (MGAS37849_02128) | - | 1024219..1024512 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37849_RS05180 (MGAS37849_02130) | - | 1024525..1025415 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37849_RS05185 (MGAS37849_02132) | - | 1025434..1026003 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37849_RS05190 (MGAS37849_02134) | - | 1026112..1026246 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37849_RS05195 (MGAS37849_02136) | - | 1026248..1026517 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37849_RS05200 (MGAS37849_02138) | - | 1026524..1027432 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37849_RS05205 (MGAS37849_02140) | - | 1027401..1028726 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37849_RS05210 (MGAS37849_02142) | - | 1028726..1030000 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37849_RS05215 (MGAS37849_02144) | - | 1029990..1030370 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37849_RS05220 (MGAS37849_02146) | - | 1030980..1031414 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37849_RS05225 (MGAS37849_02148) | - | 1031700..1031966 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37849_RS05230 (MGAS37849_02150) | - | 1031963..1032487 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37849_RS05235 (MGAS37849_02152) | - | 1032490..1033122 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37849_RS05240 (MGAS37849_02154) | - | 1033124..1033408 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37849_RS05245 (MGAS37849_02156) | - | 1033405..1033575 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37849_RS05250 (MGAS37849_02158) | - | 1033572..1033808 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37849_RS05255 (MGAS37849_02160) | - | 1033808..1034053 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37849_RS05260 (MGAS37849_02162) | - | 1034050..1034406 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37849_RS05265 (MGAS37849_02164) | - | 1034403..1034843 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37849_RS05270 | - | 1034843..1035046 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37849_RS05275 (MGAS37849_02166) | ssb | 1035052..1035477 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37849_RS05280 (MGAS37849_02168) | - | 1035470..1036144 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37849_RS05285 (MGAS37849_02170) | - | 1036145..1036627 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37849_RS05290 (MGAS37849_02172) | - | 1036649..1036903 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37849_RS05295 (MGAS37849_02174) | - | 1036884..1037237 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37849_RS05300 (MGAS37849_02178) | - | 1037378..1038160 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37849_RS05305 (MGAS37849_02180) | - | 1038147..1038977 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37849_RS05310 | - | 1038991..1039179 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS37849_RS05315 | - | 1039413..1039652 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37849_RS05320 (MGAS37849_02184) | - | 1039783..1039992 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37849_RS05325 (MGAS37849_02186) | - | 1040102..1040302 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37849_RS05330 (MGAS37849_02188) | - | 1040376..1040762 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37849_RS05335 (MGAS37849_02190) | - | 1040751..1040960 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37849_RS05340 (MGAS37849_02192) | - | 1041014..1041613 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37849_RS05345 (MGAS37849_02194) | - | 1041643..1041801 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37849_RS05350 (MGAS37849_02198) | - | 1042158..1042982 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37849_RS05355 (MGAS37849_02200) | - | 1043018..1043911 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37849_RS05360 | - | 1044032..1045120 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37849_RS05365 (MGAS37849_02206) | - | 1045483..1046103 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=977321 MGAS37849_RS05065 WP_011285559.1 1007377..1007565(-) (prx) [Streptococcus pyogenes strain MGAS37849]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=977321 MGAS37849_RS05065 WP_011285559.1 1007377..1007565(-) (prx) [Streptococcus pyogenes strain MGAS37849]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |