Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37854_RS05925 | Genome accession | NZ_CP151444 |
| Coordinates | 1173067..1173249 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37854 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173067..1206554 | 1173067..1173249 | within | 0 |
Gene organization within MGE regions
Location: 1173067..1206554
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37854_RS05925 (MGAS37854_02440) | prx | 1173067..1173249 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37854_RS05930 (MGAS37854_02442) | sda3 | 1173488..1174288 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37854_RS05935 (MGAS37854_02446) | - | 1175064..1176269 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37854_RS05940 (MGAS37854_02448) | - | 1176385..1176612 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37854_RS05945 (MGAS37854_02450) | - | 1176609..1176884 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37854_RS05950 (MGAS37854_02452) | - | 1176894..1177511 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37854_RS05955 (MGAS37854_02454) | - | 1177508..1177945 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37854_RS05960 (MGAS37854_02456) | - | 1177957..1179825 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37854_RS05965 (MGAS37854_02458) | - | 1179822..1180517 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37854_RS05970 (MGAS37854_02460) | - | 1180514..1182871 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37854_RS05975 (MGAS37854_02462) | - | 1182871..1183242 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37854_RS05980 (MGAS37854_02464) | - | 1183257..1183520 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37854_RS05985 (MGAS37854_02466) | - | 1183531..1184124 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37854_RS05990 (MGAS37854_02468) | - | 1184136..1184471 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37854_RS05995 (MGAS37854_02470) | - | 1184472..1184708 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37854_RS06000 (MGAS37854_02472) | - | 1184701..1185039 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37854_RS06005 (MGAS37854_02474) | - | 1184999..1185421 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37854_RS06010 (MGAS37854_02476) | - | 1185431..1185631 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37854_RS06015 (MGAS37854_02478) | - | 1185631..1186542 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37854_RS06020 (MGAS37854_02480) | - | 1186567..1187028 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37854_RS06025 (MGAS37854_02482) | - | 1187109..1188524 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37854_RS06030 (MGAS37854_02484) | - | 1188634..1188900 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37854_RS06035 (MGAS37854_02486) | - | 1188893..1189072 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37854_RS06040 (MGAS37854_02488) | - | 1189122..1189346 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37854_RS06045 (MGAS37854_02490) | - | 1189352..1190845 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37854_RS06050 (MGAS37854_02492) | - | 1190838..1192106 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37854_RS06055 (MGAS37854_02494) | - | 1192103..1192459 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37854_RS06060 | - | 1192608..1192952 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37854_RS06065 (MGAS37854_02496) | - | 1193061..1193480 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37854_RS06070 (MGAS37854_02498) | - | 1193748..1194383 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37854_RS06075 (MGAS37854_02500) | - | 1194385..1194654 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37854_RS06080 (MGAS37854_02502) | - | 1194738..1195250 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37854_RS06085 (MGAS37854_02504) | - | 1195247..1195588 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37854_RS06090 (MGAS37854_02506) | - | 1195766..1195933 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37854_RS06095 (MGAS37854_02508) | - | 1195943..1196740 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37854_RS06100 (MGAS37854_02510) | - | 1196737..1197666 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37854_RS06105 (MGAS37854_02512) | - | 1197669..1197998 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37854_RS06110 (MGAS37854_02514) | - | 1198054..1198260 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37854_RS06115 (MGAS37854_02516) | - | 1198269..1198409 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37854_RS06120 (MGAS37854_02518) | - | 1198406..1198639 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37854_RS06125 (MGAS37854_02520) | - | 1198620..1199009 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37854_RS06130 | - | 1199154..1199393 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37854_RS06135 (MGAS37854_02522) | - | 1199493..1199678 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37854_RS06140 (MGAS37854_02524) | - | 1199680..1199991 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37854_RS06145 (MGAS37854_02526) | - | 1200069..1200254 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37854_RS06150 (MGAS37854_02528) | - | 1200421..1200660 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37854_RS06155 (MGAS37854_02530) | - | 1200802..1201608 (+) | 807 | Protein_1166 | TIGR02391 family protein | - |
| MGAS37854_RS06160 (MGAS37854_02532) | - | 1201543..1201809 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37854_RS06165 (MGAS37854_02534) | - | 1201841..1202557 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37854_RS06170 (MGAS37854_02536) | - | 1202569..1202760 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37854_RS06175 | - | 1203396..1203491 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37854_RS06180 (MGAS37854_02540) | - | 1203914..1204261 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37854_RS06185 (MGAS37854_02542) | - | 1204265..1204645 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37854_RS06190 (MGAS37854_02544) | - | 1204657..1204923 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37854_RS06195 (MGAS37854_02546) | - | 1205047..1206189 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37854_RS06200 (MGAS37854_02548) | - | 1206279..1206554 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977157 MGAS37854_RS05925 WP_011017964.1 1173067..1173249(-) (prx) [Streptococcus pyogenes strain MGAS37854]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977157 MGAS37854_RS05925 WP_011017964.1 1173067..1173249(-) (prx) [Streptococcus pyogenes strain MGAS37854]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |