Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37859_RS05910 | Genome accession | NZ_CP151442 |
| Coordinates | 1169090..1169272 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37859 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169090..1204100 | 1169090..1169272 | within | 0 |
Gene organization within MGE regions
Location: 1169090..1204100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37859_RS05910 (MGAS37859_02434) | prx | 1169090..1169272 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37859_RS05915 (MGAS37859_02436) | sda3 | 1169511..1170311 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37859_RS05920 (MGAS37859_02438) | - | 1170582..1171016 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37859_RS05925 (MGAS37859_02440) | - | 1171086..1172291 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37859_RS05930 (MGAS37859_02442) | - | 1172407..1172634 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37859_RS05935 (MGAS37859_02444) | - | 1172631..1172906 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37859_RS05940 (MGAS37859_02446) | - | 1172916..1173533 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37859_RS05945 (MGAS37859_02448) | - | 1173530..1173967 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37859_RS05950 (MGAS37859_02450) | - | 1173979..1175847 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37859_RS05955 (MGAS37859_02452) | - | 1175844..1176539 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37859_RS05960 (MGAS37859_02454) | - | 1176536..1178893 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37859_RS05965 (MGAS37859_02456) | - | 1178893..1179264 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37859_RS05970 (MGAS37859_02458) | - | 1179279..1179542 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37859_RS05975 (MGAS37859_02460) | - | 1179553..1180146 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37859_RS05980 (MGAS37859_02462) | - | 1180158..1180493 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37859_RS05985 (MGAS37859_02464) | - | 1180494..1180730 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37859_RS05990 (MGAS37859_02466) | - | 1180723..1181061 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37859_RS05995 (MGAS37859_02468) | - | 1181021..1181443 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37859_RS06000 (MGAS37859_02470) | - | 1181453..1181653 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37859_RS06005 (MGAS37859_02472) | - | 1181653..1182564 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37859_RS06010 (MGAS37859_02474) | - | 1182589..1183050 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37859_RS06015 (MGAS37859_02476) | - | 1183131..1184546 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37859_RS06020 (MGAS37859_02478) | - | 1184656..1184922 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37859_RS06025 (MGAS37859_02480) | - | 1184915..1185094 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37859_RS06030 (MGAS37859_02482) | - | 1185144..1185368 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37859_RS06035 (MGAS37859_02484) | - | 1185374..1186867 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37859_RS06040 (MGAS37859_02486) | - | 1186860..1188128 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37859_RS06045 (MGAS37859_02488) | - | 1188125..1188481 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37859_RS06050 | - | 1188630..1188974 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37859_RS06055 (MGAS37859_02490) | - | 1189083..1189502 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37859_RS06060 (MGAS37859_02492) | - | 1189770..1190405 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37859_RS06065 (MGAS37859_02494) | - | 1190407..1190676 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37859_RS06070 (MGAS37859_02496) | - | 1190760..1191272 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37859_RS06075 (MGAS37859_02498) | - | 1191269..1191610 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37859_RS06080 (MGAS37859_02500) | - | 1191788..1191955 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37859_RS06085 (MGAS37859_02502) | - | 1191965..1192762 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37859_RS06090 (MGAS37859_02504) | - | 1192759..1193688 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37859_RS06095 (MGAS37859_02506) | - | 1193691..1194020 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37859_RS06100 (MGAS37859_02508) | - | 1194076..1194282 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37859_RS06105 (MGAS37859_02510) | - | 1194291..1194431 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37859_RS06110 (MGAS37859_02512) | - | 1194428..1194661 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37859_RS06115 (MGAS37859_02514) | - | 1194642..1195031 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37859_RS06120 (MGAS37859_02516) | - | 1195176..1195415 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37859_RS06125 (MGAS37859_02518) | - | 1195515..1195700 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37859_RS06130 (MGAS37859_02520) | - | 1195702..1196013 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37859_RS06135 (MGAS37859_02522) | - | 1196091..1196276 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37859_RS06140 (MGAS37859_02524) | - | 1196443..1196682 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37859_RS06145 (MGAS37859_02526) | - | 1196824..1197630 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37859_RS06150 (MGAS37859_02528) | - | 1197565..1197831 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37859_RS06155 (MGAS37859_02530) | - | 1197863..1198579 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37859_RS06160 (MGAS37859_02532) | - | 1198591..1198782 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37859_RS06165 | - | 1199418..1199513 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37859_RS06170 (MGAS37859_02536) | - | 1199936..1200283 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37859_RS06175 (MGAS37859_02538) | - | 1200287..1200667 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37859_RS06180 (MGAS37859_02540) | - | 1200679..1200945 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37859_RS06185 (MGAS37859_02542) | - | 1201069..1202211 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37859_RS06190 (MGAS37859_02544) | - | 1202301..1202576 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37859_RS06195 (MGAS37859_02546) | - | 1202675..1203262 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37859_RS06200 (MGAS37859_02548) | - | 1203240..1204082 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977045 MGAS37859_RS05910 WP_011017964.1 1169090..1169272(-) (prx) [Streptococcus pyogenes strain MGAS37859]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977045 MGAS37859_RS05910 WP_011017964.1 1169090..1169272(-) (prx) [Streptococcus pyogenes strain MGAS37859]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |