Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38289_RS07120 | Genome accession | NZ_CP151440 |
| Coordinates | 1402772..1402951 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS38289 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1394890..1443388 | 1402772..1402951 | within | 0 |
Gene organization within MGE regions
Location: 1394890..1443388
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38289_RS07080 (MGAS38289_02900) | - | 1394890..1395324 (-) | 435 | WP_010922579.1 | CopY/TcrY family copper transport repressor | - |
| MGAS38289_RS07085 (MGAS38289_02902) | - | 1395508..1396482 (+) | 975 | WP_227869327.1 | alpha/beta hydrolase fold domain-containing protein | - |
| MGAS38289_RS07090 (MGAS38289_02904) | rbfA | 1396616..1396966 (-) | 351 | WP_002994317.1 | 30S ribosome-binding factor RbfA | - |
| MGAS38289_RS07095 (MGAS38289_02906) | infB | 1397171..1400032 (-) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| MGAS38289_RS07100 (MGAS38289_02908) | - | 1400052..1400354 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| MGAS38289_RS07105 (MGAS38289_02910) | rnpM | 1400347..1400643 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| MGAS38289_RS07110 (MGAS38289_02912) | nusA | 1400659..1401816 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| MGAS38289_RS07115 (MGAS38289_02914) | rimP | 1401991..1402527 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| MGAS38289_RS07120 (MGAS38289_02916) | prx | 1402772..1402951 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS38289_RS07125 (MGAS38289_02918) | sda1 | 1403190..1404362 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS38289_RS07130 (MGAS38289_02920) | - | 1404478..1405674 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS38289_RS07135 (MGAS38289_02924) | - | 1405785..1405970 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS38289_RS07140 (MGAS38289_02926) | - | 1405967..1406266 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS38289_RS07145 (MGAS38289_02928) | - | 1406277..1406897 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS38289_RS07150 (MGAS38289_02930) | - | 1406900..1407061 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS38289_RS07155 (MGAS38289_02932) | - | 1407070..1408977 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS38289_RS07160 (MGAS38289_02934) | - | 1408988..1409623 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS38289_RS07165 (MGAS38289_02936) | - | 1409623..1410678 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS38289_RS07170 (MGAS38289_02938) | - | 1410675..1412657 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS38289_RS07175 (MGAS38289_02940) | - | 1412667..1413509 (-) | 843 | WP_407290348.1 | phage tail family protein | - |
| MGAS38289_RS07180 (MGAS38289_02942) | - | 1413521..1417903 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS38289_RS07185 (MGAS38289_02944) | - | 1417918..1418151 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS38289_RS07190 (MGAS38289_02946) | - | 1418226..1418681 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS38289_RS07195 (MGAS38289_02948) | - | 1418735..1419334 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS38289_RS07200 (MGAS38289_02950) | - | 1419346..1419705 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS38289_RS07205 (MGAS38289_02952) | - | 1419709..1420053 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS38289_RS07210 (MGAS38289_02954) | - | 1420050..1420328 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS38289_RS07215 (MGAS38289_02956) | - | 1420339..1420695 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS38289_RS07220 (MGAS38289_02958) | - | 1420707..1421594 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS38289_RS07225 (MGAS38289_02960) | - | 1421607..1422176 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS38289_RS07230 (MGAS38289_02962) | - | 1422332..1422598 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS38289_RS07235 | - | 1422601..1422789 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS38289_RS07240 (MGAS38289_02966) | - | 1422820..1424265 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS38289_RS07245 (MGAS38289_02968) | - | 1424225..1425757 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS38289_RS07250 (MGAS38289_02970) | - | 1425773..1427050 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS38289_RS07255 (MGAS38289_02972) | - | 1427040..1427492 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS38289_RS07260 (MGAS38289_02974) | - | 1427582..1427998 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS38289_RS07265 (MGAS38289_02976) | - | 1427995..1428186 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS38289_RS07270 (MGAS38289_02978) | - | 1428176..1429027 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS38289_RS07275 (MGAS38289_02980) | - | 1429036..1429302 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS38289_RS07280 (MGAS38289_02982) | - | 1429299..1429466 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS38289_RS07285 (MGAS38289_02984) | - | 1429467..1430789 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS38289_RS07290 (MGAS38289_02986) | - | 1430786..1431061 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS38289_RS07295 (MGAS38289_02988) | - | 1431448..1433832 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS38289_RS07300 (MGAS38289_02990) | - | 1433837..1435759 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS38289_RS07305 (MGAS38289_02992) | - | 1435802..1436359 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS38289_RS07310 (MGAS38289_02994) | - | 1436370..1436768 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS38289_RS07315 (MGAS38289_02996) | - | 1436772..1437926 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS38289_RS07320 (MGAS38289_02998) | - | 1437926..1438225 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS38289_RS07325 (MGAS38289_03000) | - | 1438313..1438516 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS38289_RS07330 (MGAS38289_03004) | - | 1438662..1439048 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS38289_RS07335 (MGAS38289_03006) | - | 1439045..1439248 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS38289_RS07340 (MGAS38289_03008) | - | 1439241..1439411 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS38289_RS07345 (MGAS38289_03010) | - | 1439408..1439683 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS38289_RS07350 (MGAS38289_03012) | - | 1439745..1439960 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS38289_RS07355 (MGAS38289_03014) | - | 1440008..1440421 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS38289_RS07360 (MGAS38289_03016) | - | 1440402..1440557 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS38289_RS07365 (MGAS38289_03018) | - | 1440883..1441233 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS38289_RS07370 (MGAS38289_03020) | - | 1441247..1441630 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38289_RS07375 (MGAS38289_03022) | - | 1441641..1442192 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS38289_RS07380 (MGAS38289_03024) | - | 1442309..1443388 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=976940 MGAS38289_RS07120 WP_002988813.1 1402772..1402951(-) (prx) [Streptococcus pyogenes strain MGAS38289]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=976940 MGAS38289_RS07120 WP_002988813.1 1402772..1402951(-) (prx) [Streptococcus pyogenes strain MGAS38289]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |