Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38289_RS05845 | Genome accession | NZ_CP151440 |
| Coordinates | 1163095..1163277 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS38289 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1163095..1196581 | 1163095..1163277 | within | 0 |
Gene organization within MGE regions
Location: 1163095..1196581
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38289_RS05845 (MGAS38289_02406) | prx | 1163095..1163277 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS38289_RS05850 (MGAS38289_02408) | sda3 | 1163516..1164316 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS38289_RS05855 (MGAS38289_02410) | - | 1164587..1165021 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS38289_RS05860 (MGAS38289_02412) | - | 1165091..1166296 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS38289_RS05865 (MGAS38289_02414) | - | 1166412..1166639 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS38289_RS05870 (MGAS38289_02416) | - | 1166636..1166911 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS38289_RS05875 (MGAS38289_02418) | - | 1166921..1167538 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS38289_RS05880 (MGAS38289_02420) | - | 1167535..1167972 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS38289_RS05885 (MGAS38289_02422) | - | 1167984..1169600 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| MGAS38289_RS05890 | - | 1169607..1169852 (-) | 246 | Protein_1126 | phage tail spike protein | - |
| MGAS38289_RS05895 (MGAS38289_02424) | - | 1169849..1170544 (-) | 696 | Protein_1127 | hypothetical protein | - |
| MGAS38289_RS05900 (MGAS38289_02426) | - | 1170541..1172898 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS38289_RS05905 (MGAS38289_02428) | - | 1172898..1173269 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS38289_RS05910 (MGAS38289_02430) | - | 1173284..1173547 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS38289_RS05915 (MGAS38289_02432) | - | 1173558..1174151 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS38289_RS05920 (MGAS38289_02434) | - | 1174163..1174498 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS38289_RS05925 (MGAS38289_02436) | - | 1174499..1174735 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS38289_RS05930 (MGAS38289_02438) | - | 1174728..1175066 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS38289_RS05935 (MGAS38289_02440) | - | 1175026..1175448 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS38289_RS05940 (MGAS38289_02442) | - | 1175458..1175658 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS38289_RS05945 (MGAS38289_02444) | - | 1175658..1176569 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS38289_RS05950 (MGAS38289_02446) | - | 1176594..1177055 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS38289_RS05955 (MGAS38289_02448) | - | 1177136..1178551 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS38289_RS05960 (MGAS38289_02450) | - | 1178661..1178927 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS38289_RS05965 (MGAS38289_02452) | - | 1178920..1179099 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS38289_RS05970 (MGAS38289_02454) | - | 1179149..1179373 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS38289_RS05975 (MGAS38289_02456) | - | 1179379..1180872 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS38289_RS05980 (MGAS38289_02458) | - | 1180865..1182133 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS38289_RS05985 (MGAS38289_02460) | - | 1182130..1182486 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS38289_RS05990 | - | 1182635..1182979 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS38289_RS05995 (MGAS38289_02462) | - | 1183088..1183507 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS38289_RS06000 (MGAS38289_02464) | - | 1183775..1184410 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS38289_RS06005 (MGAS38289_02466) | - | 1184412..1184681 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS38289_RS06010 (MGAS38289_02468) | - | 1184765..1185277 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS38289_RS06015 (MGAS38289_02470) | - | 1185274..1185615 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS38289_RS06020 (MGAS38289_02472) | - | 1185793..1185960 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS38289_RS06025 (MGAS38289_02474) | - | 1185970..1186767 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS38289_RS06030 (MGAS38289_02476) | - | 1186764..1187693 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS38289_RS06035 (MGAS38289_02478) | - | 1187696..1188025 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS38289_RS06040 (MGAS38289_02480) | - | 1188081..1188287 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS38289_RS06045 (MGAS38289_02482) | - | 1188296..1188436 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS38289_RS06050 (MGAS38289_02484) | - | 1188433..1188666 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS38289_RS06055 (MGAS38289_02486) | - | 1188647..1189036 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS38289_RS06060 | - | 1189181..1189420 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS38289_RS06065 (MGAS38289_02488) | - | 1189520..1189705 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS38289_RS06070 (MGAS38289_02490) | - | 1189707..1190018 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS38289_RS06075 (MGAS38289_02492) | - | 1190096..1190281 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS38289_RS06080 (MGAS38289_02494) | - | 1190448..1190687 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS38289_RS06085 (MGAS38289_02496) | - | 1190829..1191635 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS38289_RS06090 (MGAS38289_02498) | - | 1191570..1191836 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS38289_RS06095 (MGAS38289_02500) | - | 1191868..1192584 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS38289_RS06100 (MGAS38289_02502) | - | 1192596..1192787 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS38289_RS06105 | - | 1193423..1193518 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS38289_RS06110 (MGAS38289_02506) | - | 1193941..1194288 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS38289_RS06115 (MGAS38289_02508) | - | 1194292..1194672 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38289_RS06120 (MGAS38289_02510) | - | 1194684..1194950 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS38289_RS06125 (MGAS38289_02512) | - | 1195074..1196216 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS38289_RS06130 (MGAS38289_02514) | - | 1196306..1196581 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=976933 MGAS38289_RS05845 WP_011017964.1 1163095..1163277(-) (prx) [Streptococcus pyogenes strain MGAS38289]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=976933 MGAS38289_RS05845 WP_011017964.1 1163095..1163277(-) (prx) [Streptococcus pyogenes strain MGAS38289]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |