Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38337_RS07185 | Genome accession | NZ_CP151439 |
| Coordinates | 1408795..1408974 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS38337 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408795..1449411 | 1408795..1408974 | within | 0 |
Gene organization within MGE regions
Location: 1408795..1449411
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38337_RS07185 (MGAS38337_02942) | prx | 1408795..1408974 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS38337_RS07190 (MGAS38337_02944) | sda1 | 1409213..1410385 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS38337_RS07195 (MGAS38337_02946) | - | 1410501..1411697 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS38337_RS07200 (MGAS38337_02950) | - | 1411808..1411993 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS38337_RS07205 (MGAS38337_02952) | - | 1411990..1412289 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS38337_RS07210 (MGAS38337_02954) | - | 1412300..1412920 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS38337_RS07215 (MGAS38337_02956) | - | 1412923..1413084 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS38337_RS07220 (MGAS38337_02958) | - | 1413093..1415000 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS38337_RS07225 (MGAS38337_02960) | - | 1415011..1415646 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS38337_RS07230 (MGAS38337_02962) | - | 1415646..1416701 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS38337_RS07235 (MGAS38337_02964) | - | 1416698..1418680 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS38337_RS07240 (MGAS38337_02966) | - | 1418690..1419532 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS38337_RS07245 (MGAS38337_02968) | - | 1419544..1423926 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS38337_RS07250 (MGAS38337_02970) | - | 1423941..1424174 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS38337_RS07255 (MGAS38337_02972) | - | 1424249..1424704 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS38337_RS07260 (MGAS38337_02974) | - | 1424758..1425357 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS38337_RS07265 (MGAS38337_02976) | - | 1425369..1425728 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS38337_RS07270 (MGAS38337_02978) | - | 1425732..1426076 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS38337_RS07275 (MGAS38337_02980) | - | 1426073..1426351 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS38337_RS07280 (MGAS38337_02982) | - | 1426362..1426718 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS38337_RS07285 (MGAS38337_02984) | - | 1426730..1427617 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS38337_RS07290 (MGAS38337_02986) | - | 1427630..1428199 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS38337_RS07295 (MGAS38337_02988) | - | 1428355..1428621 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS38337_RS07300 | - | 1428624..1428812 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS38337_RS07305 (MGAS38337_02992) | - | 1428843..1430288 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS38337_RS07310 (MGAS38337_02994) | - | 1430248..1431780 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS38337_RS07315 (MGAS38337_02996) | - | 1431796..1433073 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS38337_RS07320 (MGAS38337_02998) | - | 1433063..1433515 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS38337_RS07325 (MGAS38337_03000) | - | 1433605..1434021 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS38337_RS07330 (MGAS38337_03002) | - | 1434018..1434209 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS38337_RS07335 (MGAS38337_03004) | - | 1434199..1435050 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS38337_RS07340 (MGAS38337_03006) | - | 1435059..1435325 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS38337_RS07345 (MGAS38337_03008) | - | 1435322..1435489 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS38337_RS07350 (MGAS38337_03010) | - | 1435490..1436812 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS38337_RS07355 (MGAS38337_03012) | - | 1436809..1437084 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS38337_RS07360 (MGAS38337_03014) | - | 1437471..1439855 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS38337_RS07365 (MGAS38337_03016) | - | 1439860..1441782 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS38337_RS07370 (MGAS38337_03018) | - | 1441825..1442382 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS38337_RS07375 (MGAS38337_03020) | - | 1442393..1442791 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS38337_RS07380 (MGAS38337_03022) | - | 1442795..1443949 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS38337_RS07385 (MGAS38337_03024) | - | 1443949..1444248 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS38337_RS07390 (MGAS38337_03026) | - | 1444336..1444539 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS38337_RS07395 (MGAS38337_03030) | - | 1444685..1445071 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS38337_RS07400 (MGAS38337_03032) | - | 1445068..1445271 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS38337_RS07405 (MGAS38337_03034) | - | 1445264..1445434 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS38337_RS07410 (MGAS38337_03036) | - | 1445431..1445706 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS38337_RS07415 (MGAS38337_03038) | - | 1445768..1445983 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS38337_RS07420 (MGAS38337_03040) | - | 1446031..1446444 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS38337_RS07425 (MGAS38337_03042) | - | 1446425..1446580 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS38337_RS07430 (MGAS38337_03044) | - | 1446906..1447256 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS38337_RS07435 (MGAS38337_03046) | - | 1447270..1447653 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38337_RS07440 (MGAS38337_03048) | - | 1447664..1448215 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS38337_RS07445 (MGAS38337_03050) | - | 1448332..1449411 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=976884 MGAS38337_RS07185 WP_002988813.1 1408795..1408974(-) (prx) [Streptococcus pyogenes strain MGAS38337]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=976884 MGAS38337_RS07185 WP_002988813.1 1408795..1408974(-) (prx) [Streptococcus pyogenes strain MGAS38337]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |