Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38343_RS05925 | Genome accession | NZ_CP151438 |
| Coordinates | 1169407..1169589 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS38343 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169407..1204417 | 1169407..1169589 | within | 0 |
Gene organization within MGE regions
Location: 1169407..1204417
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38343_RS05925 (MGAS38343_02436) | prx | 1169407..1169589 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS38343_RS05930 (MGAS38343_02438) | sda3 | 1169828..1170628 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS38343_RS05935 (MGAS38343_02440) | - | 1170899..1171333 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS38343_RS05940 (MGAS38343_02442) | - | 1171403..1172608 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS38343_RS05945 (MGAS38343_02444) | - | 1172724..1172951 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS38343_RS05950 (MGAS38343_02446) | - | 1172948..1173223 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS38343_RS05955 (MGAS38343_02448) | - | 1173233..1173850 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS38343_RS05960 (MGAS38343_02450) | - | 1173847..1174284 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS38343_RS05965 (MGAS38343_02452) | - | 1174296..1175912 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| MGAS38343_RS05970 | - | 1175919..1176164 (-) | 246 | Protein_1126 | phage tail spike protein | - |
| MGAS38343_RS05975 (MGAS38343_02454) | - | 1176161..1176856 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS38343_RS05980 (MGAS38343_02456) | - | 1176853..1179210 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS38343_RS05985 (MGAS38343_02458) | - | 1179210..1179581 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS38343_RS05990 (MGAS38343_02460) | - | 1179596..1179859 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS38343_RS05995 (MGAS38343_02462) | - | 1179870..1180463 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS38343_RS06000 (MGAS38343_02464) | - | 1180475..1180810 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS38343_RS06005 (MGAS38343_02466) | - | 1180811..1181047 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS38343_RS06010 (MGAS38343_02468) | - | 1181040..1181378 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS38343_RS06015 (MGAS38343_02470) | - | 1181338..1181760 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS38343_RS06020 (MGAS38343_02472) | - | 1181770..1181970 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS38343_RS06025 (MGAS38343_02474) | - | 1181970..1182881 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS38343_RS06030 (MGAS38343_02476) | - | 1182906..1183367 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS38343_RS06035 (MGAS38343_02478) | - | 1183448..1184863 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS38343_RS06040 (MGAS38343_02480) | - | 1184973..1185239 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS38343_RS06045 (MGAS38343_02482) | - | 1185232..1185411 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS38343_RS06050 (MGAS38343_02484) | - | 1185461..1185685 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS38343_RS06055 (MGAS38343_02486) | - | 1185691..1187184 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS38343_RS06060 (MGAS38343_02488) | - | 1187177..1188445 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS38343_RS06065 (MGAS38343_02490) | - | 1188442..1188798 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS38343_RS06070 | - | 1188947..1189291 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS38343_RS06075 (MGAS38343_02492) | - | 1189400..1189819 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS38343_RS06080 (MGAS38343_02494) | - | 1190087..1190722 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS38343_RS06085 (MGAS38343_02496) | - | 1190724..1190993 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS38343_RS06090 (MGAS38343_02498) | - | 1191077..1191589 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS38343_RS06095 (MGAS38343_02500) | - | 1191586..1191927 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS38343_RS06100 (MGAS38343_02502) | - | 1192105..1192272 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS38343_RS06105 (MGAS38343_02504) | - | 1192282..1193079 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS38343_RS06110 (MGAS38343_02506) | - | 1193076..1194005 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS38343_RS06115 (MGAS38343_02508) | - | 1194008..1194337 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS38343_RS06120 (MGAS38343_02510) | - | 1194393..1194599 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS38343_RS06125 (MGAS38343_02512) | - | 1194608..1194748 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS38343_RS06130 (MGAS38343_02514) | - | 1194745..1194978 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS38343_RS06135 (MGAS38343_02516) | - | 1194959..1195348 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS38343_RS06140 | - | 1195493..1195732 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS38343_RS06145 (MGAS38343_02518) | - | 1195832..1196017 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS38343_RS06150 (MGAS38343_02520) | - | 1196019..1196330 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS38343_RS06155 (MGAS38343_02522) | - | 1196408..1196593 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS38343_RS06160 (MGAS38343_02524) | - | 1196760..1196999 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS38343_RS06165 (MGAS38343_02526) | - | 1197141..1197947 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS38343_RS06170 (MGAS38343_02528) | - | 1197882..1198148 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS38343_RS06175 (MGAS38343_02530) | - | 1198180..1198896 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS38343_RS06180 (MGAS38343_02532) | - | 1198908..1199099 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS38343_RS06185 | - | 1199735..1199830 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS38343_RS06190 (MGAS38343_02536) | - | 1200253..1200600 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS38343_RS06195 (MGAS38343_02538) | - | 1200604..1200984 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38343_RS06200 (MGAS38343_02540) | - | 1200996..1201262 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS38343_RS06205 (MGAS38343_02542) | - | 1201386..1202528 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS38343_RS06210 (MGAS38343_02544) | - | 1202618..1202893 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS38343_RS06215 (MGAS38343_02546) | - | 1202992..1203579 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS38343_RS06220 (MGAS38343_02548) | - | 1203557..1204399 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=976821 MGAS38343_RS05925 WP_011017964.1 1169407..1169589(-) (prx) [Streptococcus pyogenes strain MGAS38343]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=976821 MGAS38343_RS05925 WP_011017964.1 1169407..1169589(-) (prx) [Streptococcus pyogenes strain MGAS38343]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |