Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38343_RS05080 | Genome accession | NZ_CP151438 |
| Coordinates | 1007667..1007855 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS38343 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1000083..1046393 | 1007667..1007855 | within | 0 |
Gene organization within MGE regions
Location: 1000083..1046393
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38343_RS05045 (MGAS38343_02076) | pfkA | 1000083..1001096 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS38343_RS05050 (MGAS38343_02078) | - | 1001176..1004286 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS38343_RS05055 (MGAS38343_02080) | - | 1004471..1004842 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS38343_RS05060 (MGAS38343_02082) | - | 1004842..1005540 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS38343_RS05065 (MGAS38343_02084) | - | 1005550..1006335 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS38343_RS05070 (MGAS38343_02086) | - | 1006462..1007076 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS38343_RS05080 (MGAS38343_02090) | prx | 1007667..1007855 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS38343_RS05085 (MGAS38343_02092) | speA | 1008075..1008830 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS38343_RS05090 (MGAS38343_02094) | - | 1008952..1009611 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS38343_RS05095 (MGAS38343_02096) | - | 1009611..1009832 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS38343_RS05100 (MGAS38343_02098) | - | 1009842..1010615 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS38343_RS05105 (MGAS38343_02100) | - | 1010626..1011228 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS38343_RS05110 (MGAS38343_02102) | - | 1011240..1012004 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS38343_RS05115 (MGAS38343_02104) | - | 1012006..1012338 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS38343_RS05120 (MGAS38343_02106) | - | 1012338..1012661 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS38343_RS05125 (MGAS38343_02108) | - | 1012675..1012797 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS38343_RS05130 (MGAS38343_02110) | - | 1012811..1013158 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS38343_RS05135 (MGAS38343_02112) | - | 1013169..1015031 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS38343_RS05140 (MGAS38343_02114) | - | 1015036..1018476 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS38343_RS05145 (MGAS38343_02116) | - | 1018477..1019961 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS38343_RS05150 (MGAS38343_02118) | - | 1019962..1021767 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS38343_RS05155 (MGAS38343_02120) | - | 1021760..1022218 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS38343_RS05160 (MGAS38343_02122) | - | 1022191..1022508 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS38343_RS05165 (MGAS38343_02124) | - | 1022521..1023027 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS38343_RS05170 (MGAS38343_02126) | - | 1023039..1023449 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS38343_RS05175 (MGAS38343_02128) | - | 1023451..1023846 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS38343_RS05180 (MGAS38343_02130) | - | 1023843..1024154 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS38343_RS05185 (MGAS38343_02132) | - | 1024151..1024495 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS38343_RS05190 (MGAS38343_02134) | - | 1024509..1024802 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS38343_RS05195 (MGAS38343_02136) | - | 1024815..1025705 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS38343_RS05200 (MGAS38343_02138) | - | 1025724..1026293 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS38343_RS05205 (MGAS38343_02140) | - | 1026402..1026536 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS38343_RS05210 (MGAS38343_02142) | - | 1026538..1026807 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS38343_RS05215 (MGAS38343_02144) | - | 1026814..1027722 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS38343_RS05220 (MGAS38343_02146) | - | 1027691..1029016 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS38343_RS05225 (MGAS38343_02148) | - | 1029016..1030290 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS38343_RS05230 (MGAS38343_02150) | - | 1030280..1030660 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS38343_RS05235 (MGAS38343_02152) | - | 1031270..1031704 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS38343_RS05240 (MGAS38343_02154) | - | 1031990..1032256 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS38343_RS05245 (MGAS38343_02156) | - | 1032253..1032777 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS38343_RS05250 (MGAS38343_02158) | - | 1032780..1033412 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS38343_RS05255 (MGAS38343_02160) | - | 1033414..1033698 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS38343_RS05260 (MGAS38343_02162) | - | 1033695..1033865 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS38343_RS05265 (MGAS38343_02164) | - | 1033862..1034098 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS38343_RS05270 (MGAS38343_02166) | - | 1034098..1034343 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS38343_RS05275 (MGAS38343_02168) | - | 1034340..1034696 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS38343_RS05280 (MGAS38343_02170) | - | 1034693..1035133 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS38343_RS05285 | - | 1035133..1035336 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS38343_RS05290 (MGAS38343_02172) | ssb | 1035342..1035767 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS38343_RS05295 (MGAS38343_02174) | - | 1035760..1036434 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS38343_RS05300 (MGAS38343_02176) | - | 1036435..1036917 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS38343_RS05305 (MGAS38343_02178) | - | 1036939..1037193 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS38343_RS05310 (MGAS38343_02180) | - | 1037174..1037527 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS38343_RS05315 (MGAS38343_02184) | - | 1037668..1038450 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS38343_RS05320 (MGAS38343_02186) | - | 1038437..1039267 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS38343_RS05325 | - | 1039281..1039469 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS38343_RS05330 | - | 1039703..1039942 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS38343_RS05335 (MGAS38343_02190) | - | 1040073..1040282 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS38343_RS05340 (MGAS38343_02192) | - | 1040392..1040592 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS38343_RS05345 (MGAS38343_02194) | - | 1040666..1041052 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS38343_RS05350 (MGAS38343_02196) | - | 1041041..1041250 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS38343_RS05355 (MGAS38343_02198) | - | 1041304..1041903 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS38343_RS05360 (MGAS38343_02200) | - | 1041933..1042091 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS38343_RS05365 (MGAS38343_02204) | - | 1042448..1043272 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS38343_RS05370 (MGAS38343_02206) | - | 1043308..1044201 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS38343_RS05375 | - | 1044322..1045410 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS38343_RS05380 (MGAS38343_02212) | - | 1045773..1046393 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=976817 MGAS38343_RS05080 WP_011285559.1 1007667..1007855(-) (prx) [Streptococcus pyogenes strain MGAS38343]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=976817 MGAS38343_RS05080 WP_011285559.1 1007667..1007855(-) (prx) [Streptococcus pyogenes strain MGAS38343]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |