Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38345_RS07185 | Genome accession | NZ_CP151437 |
| Coordinates | 1408793..1408972 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS38345 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408793..1449409 | 1408793..1408972 | within | 0 |
Gene organization within MGE regions
Location: 1408793..1449409
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38345_RS07185 (MGAS38345_02942) | prx | 1408793..1408972 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS38345_RS07190 (MGAS38345_02944) | sda1 | 1409211..1410383 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS38345_RS07195 (MGAS38345_02946) | - | 1410499..1411695 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS38345_RS07200 (MGAS38345_02950) | - | 1411806..1411991 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS38345_RS07205 (MGAS38345_02952) | - | 1411988..1412287 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS38345_RS07210 (MGAS38345_02954) | - | 1412298..1412918 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS38345_RS07215 (MGAS38345_02956) | - | 1412921..1413082 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS38345_RS07220 (MGAS38345_02958) | - | 1413091..1414998 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS38345_RS07225 (MGAS38345_02960) | - | 1415009..1415644 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS38345_RS07230 (MGAS38345_02962) | - | 1415644..1416699 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS38345_RS07235 (MGAS38345_02964) | - | 1416696..1418678 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS38345_RS07240 (MGAS38345_02966) | - | 1418688..1419530 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS38345_RS07245 (MGAS38345_02968) | - | 1419542..1423924 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS38345_RS07250 (MGAS38345_02970) | - | 1423939..1424172 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS38345_RS07255 (MGAS38345_02972) | - | 1424247..1424702 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS38345_RS07260 (MGAS38345_02974) | - | 1424756..1425355 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS38345_RS07265 (MGAS38345_02976) | - | 1425367..1425726 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS38345_RS07270 (MGAS38345_02978) | - | 1425730..1426074 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS38345_RS07275 (MGAS38345_02980) | - | 1426071..1426349 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS38345_RS07280 (MGAS38345_02982) | - | 1426360..1426716 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS38345_RS07285 (MGAS38345_02984) | - | 1426728..1427615 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS38345_RS07290 (MGAS38345_02986) | - | 1427628..1428197 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS38345_RS07295 (MGAS38345_02988) | - | 1428353..1428619 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS38345_RS07300 | - | 1428622..1428810 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS38345_RS07305 (MGAS38345_02992) | - | 1428841..1430286 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS38345_RS07310 (MGAS38345_02994) | - | 1430246..1431778 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS38345_RS07315 (MGAS38345_02996) | - | 1431794..1433071 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS38345_RS07320 (MGAS38345_02998) | - | 1433061..1433513 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS38345_RS07325 (MGAS38345_03000) | - | 1433603..1434019 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS38345_RS07330 (MGAS38345_03002) | - | 1434016..1434207 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS38345_RS07335 (MGAS38345_03004) | - | 1434197..1435048 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS38345_RS07340 (MGAS38345_03006) | - | 1435057..1435323 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS38345_RS07345 (MGAS38345_03008) | - | 1435320..1435487 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS38345_RS07350 (MGAS38345_03010) | - | 1435488..1436810 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS38345_RS07355 (MGAS38345_03012) | - | 1436807..1437082 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS38345_RS07360 (MGAS38345_03014) | - | 1437469..1439853 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS38345_RS07365 (MGAS38345_03016) | - | 1439858..1441780 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS38345_RS07370 (MGAS38345_03018) | - | 1441823..1442380 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS38345_RS07375 (MGAS38345_03020) | - | 1442391..1442789 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS38345_RS07380 (MGAS38345_03022) | - | 1442793..1443947 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS38345_RS07385 (MGAS38345_03024) | - | 1443947..1444246 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS38345_RS07390 (MGAS38345_03026) | - | 1444334..1444537 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS38345_RS07395 (MGAS38345_03030) | - | 1444683..1445069 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS38345_RS07400 (MGAS38345_03032) | - | 1445066..1445269 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS38345_RS07405 (MGAS38345_03034) | - | 1445262..1445432 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS38345_RS07410 (MGAS38345_03036) | - | 1445429..1445704 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS38345_RS07415 (MGAS38345_03038) | - | 1445766..1445981 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS38345_RS07420 (MGAS38345_03040) | - | 1446029..1446442 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS38345_RS07425 (MGAS38345_03042) | - | 1446423..1446578 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS38345_RS07430 (MGAS38345_03044) | - | 1446904..1447254 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS38345_RS07435 (MGAS38345_03046) | - | 1447268..1447651 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38345_RS07440 (MGAS38345_03048) | - | 1447662..1448213 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS38345_RS07445 (MGAS38345_03050) | - | 1448330..1449409 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=976772 MGAS38345_RS07185 WP_002988813.1 1408793..1408972(-) (prx) [Streptococcus pyogenes strain MGAS38345]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=976772 MGAS38345_RS07185 WP_002988813.1 1408793..1408972(-) (prx) [Streptococcus pyogenes strain MGAS38345]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |