Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38362_RS07175 | Genome accession | NZ_CP151436 |
| Coordinates | 1408794..1408973 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS38362 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408794..1449410 | 1408794..1408973 | within | 0 |
Gene organization within MGE regions
Location: 1408794..1449410
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38362_RS07175 (MGAS38362_02940) | prx | 1408794..1408973 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS38362_RS07180 (MGAS38362_02942) | sda1 | 1409212..1410384 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS38362_RS07185 (MGAS38362_02944) | - | 1410500..1411696 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS38362_RS07190 (MGAS38362_02948) | - | 1411807..1411992 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS38362_RS07195 (MGAS38362_02950) | - | 1411989..1412288 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS38362_RS07200 (MGAS38362_02952) | - | 1412299..1412919 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS38362_RS07205 (MGAS38362_02954) | - | 1412922..1413083 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS38362_RS07210 (MGAS38362_02956) | - | 1413092..1414999 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS38362_RS07215 (MGAS38362_02958) | - | 1415010..1415645 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS38362_RS07220 (MGAS38362_02960) | - | 1415645..1416700 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS38362_RS07225 (MGAS38362_02962) | - | 1416697..1418679 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS38362_RS07230 (MGAS38362_02964) | - | 1418689..1419531 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS38362_RS07235 (MGAS38362_02966) | - | 1419543..1423925 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS38362_RS07240 (MGAS38362_02968) | - | 1423940..1424173 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS38362_RS07245 (MGAS38362_02970) | - | 1424248..1424703 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS38362_RS07250 (MGAS38362_02972) | - | 1424757..1425356 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS38362_RS07255 (MGAS38362_02974) | - | 1425368..1425727 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS38362_RS07260 (MGAS38362_02976) | - | 1425731..1426075 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS38362_RS07265 (MGAS38362_02978) | - | 1426072..1426350 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS38362_RS07270 (MGAS38362_02980) | - | 1426361..1426717 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS38362_RS07275 (MGAS38362_02982) | - | 1426729..1427616 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS38362_RS07280 (MGAS38362_02984) | - | 1427629..1428198 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS38362_RS07285 (MGAS38362_02986) | - | 1428354..1428620 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS38362_RS07290 | - | 1428623..1428811 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS38362_RS07295 (MGAS38362_02990) | - | 1428842..1430287 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS38362_RS07300 (MGAS38362_02992) | - | 1430247..1431779 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS38362_RS07305 (MGAS38362_02994) | - | 1431795..1433072 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS38362_RS07310 (MGAS38362_02996) | - | 1433062..1433514 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS38362_RS07315 (MGAS38362_02998) | - | 1433604..1434020 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS38362_RS07320 (MGAS38362_03000) | - | 1434017..1434208 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS38362_RS07325 (MGAS38362_03002) | - | 1434198..1435049 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS38362_RS07330 (MGAS38362_03004) | - | 1435058..1435324 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS38362_RS07335 (MGAS38362_03006) | - | 1435321..1435488 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS38362_RS07340 (MGAS38362_03008) | - | 1435489..1436811 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS38362_RS07345 (MGAS38362_03010) | - | 1436808..1437083 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS38362_RS07350 (MGAS38362_03012) | - | 1437470..1439854 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS38362_RS07355 (MGAS38362_03014) | - | 1439859..1441781 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS38362_RS07360 (MGAS38362_03016) | - | 1441824..1442381 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS38362_RS07365 (MGAS38362_03018) | - | 1442392..1442790 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS38362_RS07370 (MGAS38362_03020) | - | 1442794..1443948 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS38362_RS07375 (MGAS38362_03022) | - | 1443948..1444247 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS38362_RS07380 (MGAS38362_03024) | - | 1444335..1444538 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS38362_RS07385 (MGAS38362_03028) | - | 1444684..1445070 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS38362_RS07390 (MGAS38362_03030) | - | 1445067..1445270 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS38362_RS07395 (MGAS38362_03032) | - | 1445263..1445433 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS38362_RS07400 (MGAS38362_03034) | - | 1445430..1445705 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS38362_RS07405 (MGAS38362_03036) | - | 1445767..1445982 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS38362_RS07410 (MGAS38362_03038) | - | 1446030..1446443 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS38362_RS07415 (MGAS38362_03040) | - | 1446424..1446579 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS38362_RS07420 (MGAS38362_03042) | - | 1446905..1447255 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS38362_RS07425 (MGAS38362_03044) | - | 1447269..1447652 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38362_RS07430 (MGAS38362_03046) | - | 1447663..1448214 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS38362_RS07435 (MGAS38362_03048) | - | 1448331..1449410 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=976716 MGAS38362_RS07175 WP_002988813.1 1408794..1408973(-) (prx) [Streptococcus pyogenes strain MGAS38362]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=976716 MGAS38362_RS07175 WP_002988813.1 1408794..1408973(-) (prx) [Streptococcus pyogenes strain MGAS38362]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |