Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS38362_RS05905 | Genome accession | NZ_CP151436 |
| Coordinates | 1169117..1169299 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS38362 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169117..1204127 | 1169117..1169299 | within | 0 |
Gene organization within MGE regions
Location: 1169117..1204127
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38362_RS05905 (MGAS38362_02430) | prx | 1169117..1169299 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS38362_RS05910 (MGAS38362_02432) | sda3 | 1169538..1170338 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS38362_RS05915 (MGAS38362_02434) | - | 1170609..1171043 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS38362_RS05920 (MGAS38362_02436) | - | 1171113..1172318 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS38362_RS05925 (MGAS38362_02438) | - | 1172434..1172661 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS38362_RS05930 (MGAS38362_02440) | - | 1172658..1172933 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS38362_RS05935 (MGAS38362_02442) | - | 1172943..1173560 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS38362_RS05940 (MGAS38362_02444) | - | 1173557..1173994 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS38362_RS05945 (MGAS38362_02446) | - | 1174006..1175874 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS38362_RS05950 (MGAS38362_02448) | - | 1175871..1176566 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS38362_RS05955 (MGAS38362_02450) | - | 1176563..1178920 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS38362_RS05960 (MGAS38362_02452) | - | 1178920..1179291 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS38362_RS05965 (MGAS38362_02454) | - | 1179306..1179569 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS38362_RS05970 (MGAS38362_02456) | - | 1179580..1180173 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS38362_RS05975 (MGAS38362_02458) | - | 1180185..1180520 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS38362_RS05980 (MGAS38362_02460) | - | 1180521..1180757 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS38362_RS05985 (MGAS38362_02462) | - | 1180750..1181088 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS38362_RS05990 (MGAS38362_02464) | - | 1181048..1181470 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS38362_RS05995 (MGAS38362_02466) | - | 1181480..1181680 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS38362_RS06000 (MGAS38362_02468) | - | 1181680..1182591 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS38362_RS06005 (MGAS38362_02470) | - | 1182616..1183077 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS38362_RS06010 (MGAS38362_02472) | - | 1183158..1184573 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS38362_RS06015 (MGAS38362_02474) | - | 1184683..1184949 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS38362_RS06020 (MGAS38362_02476) | - | 1184942..1185121 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS38362_RS06025 (MGAS38362_02478) | - | 1185171..1185395 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS38362_RS06030 (MGAS38362_02480) | - | 1185401..1186894 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS38362_RS06035 (MGAS38362_02482) | - | 1186887..1188155 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS38362_RS06040 (MGAS38362_02484) | - | 1188152..1188508 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS38362_RS06045 | - | 1188657..1189001 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS38362_RS06050 (MGAS38362_02486) | - | 1189110..1189529 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS38362_RS06055 (MGAS38362_02488) | - | 1189797..1190432 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS38362_RS06060 (MGAS38362_02490) | - | 1190434..1190703 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS38362_RS06065 (MGAS38362_02492) | - | 1190787..1191299 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS38362_RS06070 (MGAS38362_02494) | - | 1191296..1191637 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS38362_RS06075 (MGAS38362_02496) | - | 1191815..1191982 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS38362_RS06080 (MGAS38362_02498) | - | 1191992..1192789 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS38362_RS06085 (MGAS38362_02500) | - | 1192786..1193715 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS38362_RS06090 (MGAS38362_02502) | - | 1193718..1194047 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS38362_RS06095 (MGAS38362_02504) | - | 1194103..1194309 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS38362_RS06100 (MGAS38362_02506) | - | 1194318..1194458 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS38362_RS06105 (MGAS38362_02508) | - | 1194455..1194688 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS38362_RS06110 (MGAS38362_02510) | - | 1194669..1195058 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS38362_RS06115 | - | 1195203..1195442 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS38362_RS06120 (MGAS38362_02512) | - | 1195542..1195727 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS38362_RS06125 (MGAS38362_02514) | - | 1195729..1196040 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS38362_RS06130 (MGAS38362_02516) | - | 1196118..1196303 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS38362_RS06135 (MGAS38362_02518) | - | 1196470..1196709 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS38362_RS06140 (MGAS38362_02520) | - | 1196851..1197657 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS38362_RS06145 (MGAS38362_02522) | - | 1197592..1197858 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS38362_RS06150 (MGAS38362_02524) | - | 1197890..1198606 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS38362_RS06155 (MGAS38362_02526) | - | 1198618..1198809 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS38362_RS06160 | - | 1199445..1199540 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS38362_RS06165 (MGAS38362_02530) | - | 1199963..1200310 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS38362_RS06170 (MGAS38362_02532) | - | 1200314..1200694 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS38362_RS06175 (MGAS38362_02534) | - | 1200706..1200972 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS38362_RS06180 (MGAS38362_02536) | - | 1201096..1202238 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS38362_RS06185 (MGAS38362_02538) | - | 1202328..1202603 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS38362_RS06190 (MGAS38362_02540) | - | 1202702..1203289 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS38362_RS06195 (MGAS38362_02542) | - | 1203267..1204109 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=976709 MGAS38362_RS05905 WP_011017964.1 1169117..1169299(-) (prx) [Streptococcus pyogenes strain MGAS38362]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=976709 MGAS38362_RS05905 WP_011017964.1 1169117..1169299(-) (prx) [Streptococcus pyogenes strain MGAS38362]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |