Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AADW57_RS13345 Genome accession   NZ_CP151273
Coordinates   2877015..2877518 (+) Length   167 a.a.
NCBI ID   WP_341667386.1    Uniprot ID   -
Organism   Alcaligenes sp. SDU_A2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2835289..2887620 2877015..2877518 within 0


Gene organization within MGE regions


Location: 2835289..2887620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AADW57_RS13060 (AADW57_13060) - 2835289..2835747 (-) 459 WP_341667329.1 lysozyme -
  AADW57_RS13065 (AADW57_13065) - 2835731..2835988 (-) 258 WP_131070752.1 hypothetical protein -
  AADW57_RS13070 (AADW57_13070) - 2836039..2836473 (-) 435 WP_341667330.1 hypothetical protein -
  AADW57_RS13075 (AADW57_13075) - 2836457..2836837 (-) 381 WP_341667331.1 hypothetical protein -
  AADW57_RS13080 (AADW57_13080) - 2836837..2837853 (-) 1017 WP_341667332.1 hypothetical protein -
  AADW57_RS13085 (AADW57_13085) - 2837840..2838031 (-) 192 WP_341667333.1 hypothetical protein -
  AADW57_RS13090 (AADW57_13090) - 2838221..2838595 (-) 375 WP_341667334.1 hypothetical protein -
  AADW57_RS13095 (AADW57_13095) - 2838598..2842503 (-) 3906 WP_341667335.1 phage tail protein -
  AADW57_RS13100 (AADW57_13100) - 2842503..2843108 (-) 606 WP_341667336.1 tail assembly protein -
  AADW57_RS13105 (AADW57_13105) - 2843105..2843887 (-) 783 WP_341667337.1 C40 family peptidase -
  AADW57_RS13110 (AADW57_13110) - 2843941..2844330 (-) 390 WP_341667338.1 hypothetical protein -
  AADW57_RS13115 (AADW57_13115) - 2844384..2845127 (-) 744 WP_341667339.1 phage minor tail protein L -
  AADW57_RS13120 (AADW57_13120) - 2845124..2845465 (-) 342 WP_341667340.1 phage tail protein -
  AADW57_RS13125 (AADW57_13125) - 2845462..2848521 (-) 3060 WP_341667341.1 tape measure protein -
  AADW57_RS13130 (AADW57_13130) - 2848586..2848993 (-) 408 WP_341667342.1 J517_1871 family lipoprotein -
  AADW57_RS13135 (AADW57_13135) - 2849084..2849653 (-) 570 WP_341667343.1 hypothetical protein -
  AADW57_RS13140 (AADW57_13140) - 2849663..2850730 (-) 1068 WP_341667344.1 hypothetical protein -
  AADW57_RS13145 (AADW57_13145) - 2851365..2851838 (-) 474 WP_341667345.1 hypothetical protein -
  AADW57_RS13150 (AADW57_13150) - 2851848..2852771 (-) 924 WP_341667346.1 phage tail tube protein -
  AADW57_RS13155 (AADW57_13155) - 2852817..2853323 (-) 507 WP_341667347.1 Rha family transcriptional regulator -
  AADW57_RS13160 (AADW57_13160) - 2853478..2853897 (-) 420 WP_341667348.1 phage tail terminator-like protein -
  AADW57_RS13165 (AADW57_13165) - 2853894..2854283 (-) 390 WP_341667349.1 hypothetical protein -
  AADW57_RS13170 (AADW57_13170) - 2854285..2854641 (-) 357 WP_341667350.1 hypothetical protein -
  AADW57_RS13175 (AADW57_13175) - 2854643..2855023 (-) 381 WP_341667351.1 hypothetical protein -
  AADW57_RS13180 (AADW57_13180) - 2855030..2855398 (-) 369 WP_341667352.1 hypothetical protein -
  AADW57_RS13185 (AADW57_13185) - 2855401..2855727 (-) 327 WP_341667353.1 Ish1 domain-containing protein -
  AADW57_RS13190 (AADW57_13190) - 2855767..2856720 (-) 954 WP_341667354.1 major capsid protein -
  AADW57_RS13195 (AADW57_13195) - 2856733..2857494 (-) 762 WP_341667355.1 hypothetical protein -
  AADW57_RS13200 (AADW57_13200) - 2857594..2857719 (-) 126 WP_268378279.1 hypothetical protein -
  AADW57_RS13205 (AADW57_13205) - 2857739..2858935 (-) 1197 WP_341667356.1 minor capsid protein -
  AADW57_RS13210 (AADW57_13210) - 2858919..2860289 (-) 1371 WP_341667357.1 DUF4055 domain-containing protein -
  AADW57_RS13215 (AADW57_13215) - 2860289..2861569 (-) 1281 WP_341667358.1 terminase family protein -
  AADW57_RS13220 (AADW57_13220) - 2861508..2862059 (-) 552 WP_341667360.1 HGGxSTG domain-containing protein -
  AADW57_RS13225 (AADW57_13225) - 2862232..2862657 (-) 426 WP_341667361.1 hypothetical protein -
  AADW57_RS13230 (AADW57_13230) - 2862654..2863355 (-) 702 WP_341667362.1 phosphoadenosine phosphosulfate reductase -
  AADW57_RS13235 (AADW57_13235) - 2863421..2863675 (+) 255 WP_341667363.1 hypothetical protein -
  AADW57_RS13240 (AADW57_13240) - 2864010..2864369 (-) 360 WP_341667364.1 hypothetical protein -
  AADW57_RS13245 (AADW57_13245) - 2864519..2864854 (-) 336 WP_341667365.1 DUF1064 domain-containing protein -
  AADW57_RS13250 (AADW57_13250) - 2864851..2865504 (-) 654 WP_341667366.1 DUF6475 domain-containing protein -
  AADW57_RS13255 (AADW57_13255) - 2865506..2866336 (-) 831 WP_341667367.1 helix-turn-helix domain-containing protein -
  AADW57_RS13260 (AADW57_13260) - 2866333..2866734 (-) 402 WP_341667368.1 nuclease domain-containing protein -
  AADW57_RS13265 (AADW57_13265) - 2866731..2867162 (-) 432 WP_341667369.1 hypothetical protein -
  AADW57_RS13270 (AADW57_13270) - 2867164..2867736 (-) 573 WP_341667370.1 hypothetical protein -
  AADW57_RS13275 (AADW57_13275) - 2867800..2868006 (+) 207 WP_341667371.1 hypothetical protein -
  AADW57_RS13280 (AADW57_13280) - 2868049..2868255 (-) 207 WP_341667372.1 Cro/CI family transcriptional regulator -
  AADW57_RS13285 (AADW57_13285) - 2868330..2868707 (+) 378 WP_341667373.1 hypothetical protein -
  AADW57_RS13290 (AADW57_13290) - 2869184..2870293 (+) 1110 WP_341667374.1 helix-turn-helix domain-containing protein -
  AADW57_RS13295 (AADW57_13295) - 2870490..2870828 (+) 339 WP_341667375.1 hypothetical protein -
  AADW57_RS13300 (AADW57_13300) - 2871323..2871487 (+) 165 WP_341667376.1 hypothetical protein -
  AADW57_RS13305 (AADW57_13305) - 2871484..2871948 (+) 465 WP_341667377.1 hypothetical protein -
  AADW57_RS13310 (AADW57_13310) - 2871963..2872388 (+) 426 WP_341667378.1 hypothetical protein -
  AADW57_RS13315 (AADW57_13315) - 2873119..2873469 (+) 351 WP_341667379.1 hypothetical protein -
  AADW57_RS13320 (AADW57_13320) - 2873561..2873818 (+) 258 WP_341667380.1 hypothetical protein -
  AADW57_RS13325 (AADW57_13325) - 2873808..2874044 (+) 237 WP_341667381.1 hypothetical protein -
  AADW57_RS13330 (AADW57_13330) - 2874245..2875312 (+) 1068 WP_341667382.1 hypothetical protein -
  AADW57_RS13335 (AADW57_13335) - 2875320..2876243 (+) 924 WP_341667384.1 recombinase RecT -
  AADW57_RS13340 (AADW57_13340) - 2876240..2877013 (+) 774 WP_341667385.1 lambda exonuclease family protein -
  AADW57_RS13345 (AADW57_13345) ssb 2877015..2877518 (+) 504 WP_341667386.1 single-stranded DNA-binding protein Machinery gene
  AADW57_RS13350 (AADW57_13350) - 2877608..2878177 (+) 570 WP_341667387.1 hypothetical protein -
  AADW57_RS13355 (AADW57_13355) - 2878214..2878639 (+) 426 WP_341667388.1 hypothetical protein -
  AADW57_RS13360 (AADW57_13360) - 2878672..2879133 (+) 462 WP_341667389.1 four helix bundle protein -
  AADW57_RS13365 (AADW57_13365) - 2879191..2880405 (+) 1215 WP_341667390.1 RNA-directed DNA polymerase -
  AADW57_RS13370 (AADW57_13370) - 2880607..2880996 (+) 390 WP_341667391.1 hypothetical protein -
  AADW57_RS13375 (AADW57_13375) - 2881148..2882236 (+) 1089 WP_341667392.1 hypothetical protein -
  AADW57_RS13380 (AADW57_13380) - 2882233..2882421 (+) 189 WP_341667393.1 hypothetical protein -
  AADW57_RS13385 (AADW57_13385) - 2882418..2882756 (+) 339 WP_341667394.1 hypothetical protein -
  AADW57_RS13390 (AADW57_13390) - 2883163..2883387 (+) 225 WP_341667395.1 DUF4224 domain-containing protein -
  AADW57_RS13395 (AADW57_13395) - 2883384..2884418 (+) 1035 WP_341667396.1 site-specific integrase -
  AADW57_RS13400 (AADW57_13400) - 2884804..2885061 (+) 258 WP_341667397.1 hypothetical protein -
  AADW57_RS13405 (AADW57_13405) - 2885046..2886515 (+) 1470 WP_341667398.1 phospholipase D-like domain-containing protein -
  AADW57_RS13410 (AADW57_13410) paaX 2886676..2887620 (+) 945 WP_341667399.1 phenylacetic acid degradation operon negative regulatory protein PaaX -

Sequence

Protein


Download         Length: 167 a.a.        Molecular weight: 18912.82 Da        Isoelectric Point: 5.3563

>NTDB_id=976037 AADW57_RS13345 WP_341667386.1 2877015..2877518(+) (ssb) [Alcaligenes sp. SDU_A2]
MASVNKVILIGNLGRDPEVRYSAEGSAICNISIATTSQWKDRNSGERREETEWHRVVFYNRLAEIAGEYLKKGRSVYVEG
RLRTRKWTGQDGQERFTTEVIAEQMQMLGGRDGGGESYGSAPQPEQRQSHCQQRNNYADTEGRGQQRQAPPPMTDNLADM
DDDIPFN

Nucleotide


Download         Length: 504 bp        

>NTDB_id=976037 AADW57_RS13345 WP_341667386.1 2877015..2877518(+) (ssb) [Alcaligenes sp. SDU_A2]
ATGGCATCGGTAAATAAAGTCATTCTGATCGGCAATCTCGGCCGCGACCCAGAAGTACGCTACAGCGCGGAAGGTTCGGC
CATCTGCAATATTTCCATTGCCACGACCTCGCAGTGGAAAGATCGCAACTCCGGCGAACGCCGCGAGGAAACCGAGTGGC
ACCGCGTGGTGTTCTATAACCGTCTGGCCGAAATCGCCGGCGAATACCTGAAAAAAGGCCGCTCGGTCTATGTAGAAGGT
CGTCTGCGTACGCGCAAATGGACAGGCCAGGACGGTCAGGAGCGTTTCACTACTGAGGTCATTGCCGAGCAAATGCAAAT
GCTTGGTGGCCGCGACGGTGGAGGCGAAAGCTACGGCAGCGCGCCCCAGCCAGAGCAGCGGCAATCACACTGCCAGCAGC
GCAACAACTACGCAGACACCGAAGGGCGCGGGCAGCAAAGACAAGCCCCGCCTCCCATGACGGATAACTTAGCCGACATG
GATGACGACATACCTTTTAACTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

49.718

100

0.527
  ssb Neisseria meningitidis MC58

49.714

100

0.521
  ssb Neisseria gonorrhoeae MS11

49.714

100

0.521
  ssb Glaesserella parasuis strain SC1401

46.739

100

0.515

Multiple sequence alignment