Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC53_RS07855 | Genome accession | NZ_CP150781 |
| Coordinates | 1608593..1609063 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934765.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM20820 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1591145..1638567 | 1608593..1609063 | within | 0 |
Gene organization within MGE regions
Location: 1591145..1638567
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC53_RS07740 (WOC53_07735) | - | 1591145..1591990 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| WOC53_RS07745 (WOC53_07740) | - | 1592362..1593585 (-) | 1224 | WP_000206623.1 | ArgE/DapE family deacylase | - |
| WOC53_RS07750 (WOC53_07745) | lukH | 1594021..1595073 (+) | 1053 | WP_000791417.1 | bi-component leukocidin LukGH subunit H | - |
| WOC53_RS07755 (WOC53_07750) | lukG | 1595095..1596111 (+) | 1017 | WP_261921484.1 | bi-component leukocidin LukGH subunit G | - |
| WOC53_RS07760 (WOC53_07755) | sph | 1596349..1597173 (-) | 825 | Protein_1513 | sphingomyelin phosphodiesterase | - |
| WOC53_RS07765 (WOC53_07760) | - | 1597230..1598267 (-) | 1038 | WP_000857182.1 | site-specific integrase | - |
| WOC53_RS07770 (WOC53_07765) | sek | 1598351..1599079 (-) | 729 | WP_000733771.1 | staphylococcal enterotoxin type K | - |
| WOC53_RS07775 (WOC53_07770) | seq | 1599103..1599831 (-) | 729 | WP_001033320.1 | staphylococcal enterotoxin type Q | - |
| WOC53_RS07780 (WOC53_07775) | - | 1600027..1600797 (-) | 771 | WP_001208482.1 | S24 family peptidase | - |
| WOC53_RS07785 (WOC53_07780) | - | 1600956..1601180 (+) | 225 | WP_000338186.1 | DUF739 family protein | - |
| WOC53_RS07790 (WOC53_07785) | - | 1601198..1601458 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| WOC53_RS07795 (WOC53_07790) | - | 1601482..1602021 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| WOC53_RS07800 (WOC53_07795) | - | 1602078..1602827 (+) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC53_RS07805 (WOC53_07800) | - | 1602843..1603040 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| WOC53_RS07810 (WOC53_07805) | - | 1603071..1603211 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| WOC53_RS07815 (WOC53_07810) | - | 1603226..1603858 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| WOC53_RS07820 (WOC53_07815) | - | 1603917..1604237 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| WOC53_RS07825 (WOC53_07820) | - | 1604234..1604395 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| WOC53_RS07830 (WOC53_07825) | - | 1604488..1604748 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| WOC53_RS07835 (WOC53_07830) | - | 1604757..1605020 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC53_RS07840 (WOC53_07835) | - | 1605017..1606972 (+) | 1956 | WP_064138715.1 | AAA family ATPase | - |
| WOC53_RS07845 (WOC53_07840) | - | 1606974..1607894 (+) | 921 | WP_340790659.1 | recombinase RecT | - |
| WOC53_RS07850 (WOC53_07845) | - | 1607975..1608592 (+) | 618 | WP_072353921.1 | MBL fold metallo-hydrolase | - |
| WOC53_RS07855 (WOC53_07850) | ssbA | 1608593..1609063 (+) | 471 | WP_000934765.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC53_RS07860 (WOC53_07855) | - | 1609093..1609986 (+) | 894 | WP_000148328.1 | DnaD domain-containing protein | - |
| WOC53_RS07865 (WOC53_07860) | - | 1609993..1610211 (+) | 219 | WP_000338527.1 | hypothetical protein | - |
| WOC53_RS07870 (WOC53_07865) | - | 1610220..1610624 (+) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC53_RS07875 (WOC53_07870) | - | 1610637..1610921 (+) | 285 | Protein_1536 | SA1788 family PVL leukocidin-associated protein | - |
| WOC53_RS07880 (WOC53_07880) | rinB | 1610965..1611114 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| WOC53_RS07885 (WOC53_07885) | - | 1611273..1611923 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| WOC53_RS07890 (WOC53_07890) | - | 1611923..1612123 (+) | 201 | WP_001570807.1 | DUF1514 family protein | - |
| WOC53_RS07895 (WOC53_07895) | - | 1612146..1612616 (+) | 471 | WP_000282755.1 | hypothetical protein | - |
| WOC53_RS07900 (WOC53_07900) | - | 1612731..1613183 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| WOC53_RS07905 (WOC53_07905) | - | 1613199..1613543 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| WOC53_RS07910 (WOC53_07910) | - | 1613672..1614139 (+) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| WOC53_RS07915 (WOC53_07915) | - | 1614142..1615836 (+) | 1695 | WP_000133304.1 | terminase large subunit | - |
| WOC53_RS07920 (WOC53_07920) | - | 1615850..1616050 (+) | 201 | WP_000365299.1 | hypothetical protein | - |
| WOC53_RS07925 (WOC53_07925) | - | 1616056..1617306 (+) | 1251 | WP_000511067.1 | phage portal protein | - |
| WOC53_RS07930 (WOC53_07930) | - | 1617299..1617883 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| WOC53_RS07935 (WOC53_07935) | - | 1617971..1619218 (+) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| WOC53_RS07940 (WOC53_07940) | - | 1619254..1619412 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| WOC53_RS07945 (WOC53_07945) | - | 1619421..1619753 (+) | 333 | WP_001177483.1 | head-tail connector protein | - |
| WOC53_RS07950 (WOC53_07950) | - | 1619740..1620075 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| WOC53_RS07955 (WOC53_07955) | - | 1620075..1620452 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WOC53_RS07960 (WOC53_07960) | - | 1620449..1620829 (+) | 381 | WP_000611454.1 | hypothetical protein | - |
| WOC53_RS07965 (WOC53_07965) | - | 1620830..1621783 (+) | 954 | WP_000570652.1 | major tail protein | - |
| WOC53_RS07970 (WOC53_07970) | gpG | 1621848..1622294 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| WOC53_RS07975 (WOC53_07975) | gpGT | 1622354..1622476 (+) | 123 | WP_000570353.1 | phage tail assembly chaperone GT | - |
| WOC53_RS07980 (WOC53_07980) | - | 1622532..1627181 (+) | 4650 | WP_368409822.1 | phage tail tape measure protein | - |
| WOC53_RS07985 (WOC53_07985) | - | 1627181..1628671 (+) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| WOC53_RS07990 (WOC53_07990) | - | 1628687..1632469 (+) | 3783 | WP_117219101.1 | phage tail spike protein | - |
| WOC53_RS07995 (WOC53_07995) | - | 1632462..1632614 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| WOC53_RS08000 (WOC53_08000) | - | 1632660..1632947 (+) | 288 | WP_001262621.1 | hypothetical protein | - |
| WOC53_RS08005 (WOC53_08005) | - | 1633003..1633377 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| WOC53_RS08010 (WOC53_08010) | sea | 1633750..1634523 (+) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| WOC53_RS08015 (WOC53_08015) | pepG1 | 1634674..1634808 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WOC53_RS08020 (WOC53_08020) | - | 1634861..1634968 (-) | 108 | WP_031762631.1 | hypothetical protein | - |
| WOC53_RS08025 (WOC53_08025) | - | 1635016..1635270 (+) | 255 | WP_000611512.1 | phage holin | - |
| WOC53_RS08030 (WOC53_08030) | - | 1635282..1636037 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WOC53_RS08035 (WOC53_08035) | sak | 1636228..1636719 (+) | 492 | WP_000920038.1 | staphylokinase | - |
| WOC53_RS08040 (WOC53_08040) | - | 1637367..1637705 (+) | 339 | Protein_1569 | SH3 domain-containing protein | - |
| WOC53_RS08045 (WOC53_08045) | scn | 1638217..1638567 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17673.54 Da Isoelectric Point: 4.9627
>NTDB_id=972526 WOC53_RS07855 WP_000934765.1 1608593..1609063(+) (ssbA) [Staphylococcus aureus strain TUM20820]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTDDNQQDLYQQQAQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTDDNQQDLYQQQAQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972526 WOC53_RS07855 WP_000934765.1 1608593..1609063(+) (ssbA) [Staphylococcus aureus strain TUM20820]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAGATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAGATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |