Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NSU16_RS12220 Genome accession   NZ_CP150176
Coordinates   2402955..2403302 (-) Length   115 a.a.
NCBI ID   WP_168748233.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-1003     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2397955..2408302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU16_RS12175 (NSU16_12175) sinI 2398480..2398653 (+) 174 WP_339190978.1 anti-repressor SinI family protein Regulator
  NSU16_RS12180 (NSU16_12180) sinR 2398687..2399022 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSU16_RS12185 (NSU16_12185) tasA 2399110..2399895 (-) 786 WP_168748227.1 biofilm matrix protein TasA -
  NSU16_RS12190 (NSU16_12190) - 2399960..2400544 (-) 585 WP_339190980.1 signal peptidase I -
  NSU16_RS12195 (NSU16_12195) tapA 2400516..2401277 (-) 762 WP_339190983.1 amyloid fiber anchoring/assembly protein TapA -
  NSU16_RS12200 (NSU16_12200) - 2401554..2401877 (+) 324 WP_168748230.1 YqzG/YhdC family protein -
  NSU16_RS12205 (NSU16_12205) - 2401920..2402099 (-) 180 WP_003236949.1 YqzE family protein -
  NSU16_RS12210 (NSU16_12210) comGG 2402171..2402545 (-) 375 WP_286058321.1 competence type IV pilus minor pilin ComGG Machinery gene
  NSU16_RS12215 (NSU16_12215) comGF 2402546..2402929 (-) 384 WP_026014740.1 competence type IV pilus minor pilin ComGF Machinery gene
  NSU16_RS12220 (NSU16_12220) comGE 2402955..2403302 (-) 348 WP_168748233.1 competence type IV pilus minor pilin ComGE Machinery gene
  NSU16_RS12225 (NSU16_12225) comGD 2403286..2403717 (-) 432 WP_168748234.1 competence type IV pilus minor pilin ComGD Machinery gene
  NSU16_RS12230 (NSU16_12230) comGC 2403707..2404003 (-) 297 WP_168748235.1 competence type IV pilus major pilin ComGC Machinery gene
  NSU16_RS12235 (NSU16_12235) comGB 2404017..2405054 (-) 1038 WP_339190988.1 competence type IV pilus assembly protein ComGB Machinery gene
  NSU16_RS12240 (NSU16_12240) comGA 2405041..2406111 (-) 1071 WP_168748237.1 competence protein ComGA Machinery gene
  NSU16_RS12245 (NSU16_12245) - 2406464..2406634 (-) 171 WP_339190991.1 hypothetical protein -
  NSU16_RS12250 (NSU16_12250) - 2406866..2407816 (-) 951 WP_010334929.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13254.06 Da        Isoelectric Point: 4.3440

>NTDB_id=965007 NSU16_RS12220 WP_168748233.1 2402955..2403302(-) (comGE) [Bacillus sp. FSL K6-1003]
MWRENKGFSTIETMSALSIWLFMLLTIVPMWDKLIADEHIADSREIGYQLVNESIGQYMLTGAGNSSKTVSMNNNKYSMT
WEEEGEYQNVCISSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=965007 NSU16_RS12220 WP_168748233.1 2402955..2403302(-) (comGE) [Bacillus sp. FSL K6-1003]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGTCTGCCCTTAGCATATGGCTGTTTATGCTTCTGACAAT
TGTGCCGATGTGGGATAAGCTGATAGCTGATGAACATATAGCGGACTCCAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCCAATATATGCTGACAGGGGCAGGAAATTCATCAAAGACTGTTTCAATGAACAATAACAAATACTCGATGACA
TGGGAGGAGGAGGGAGAATATCAAAACGTATGTATCTCATCAGACGCCTATAAAGATAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

71.304

100

0.713

Multiple sequence alignment