Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | QML92_RS03310 | Genome accession | NZ_AP025937 |
| Coordinates | 662280..662870 (+) | Length | 196 a.a. |
| NCBI ID | WP_000613477.1 | Uniprot ID | A0A064BX72 |
| Organism | Streptococcus pneumoniae strain PZ900700792 | ||
| Function | degradation of ComX; degradation of ComW (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 638323..692881 | 662280..662870 | within | 0 |
Gene organization within MGE regions
Location: 638323..692881
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QML92_RS03180 (PC0780_06220) | thiM | 638455..639237 (+) | 783 | WP_000202457.1 | hydroxyethylthiazole kinase | - |
| QML92_RS03185 (PC0780_06230) | thiE | 639239..639868 (+) | 630 | WP_000468578.1 | thiamine phosphate synthase | - |
| QML92_RS03190 (PC0780_06240) | - | 640427..640987 (+) | 561 | WP_000915281.1 | ECF transporter S component | - |
| QML92_RS03195 (PC0780_06250) | - | 640988..642373 (+) | 1386 | WP_000522108.1 | ABC transporter ATP-binding protein | - |
| QML92_RS03200 (PC0780_06260) | - | 642375..643025 (+) | 651 | WP_000241371.1 | energy-coupling factor transporter transmembrane component T | - |
| QML92_RS03205 (PC0780_06270) | tenA | 643036..643728 (+) | 693 | WP_000397212.1 | thiaminase II | - |
| QML92_RS03210 (PC0780_06280) | thiW | 643733..644257 (+) | 525 | WP_001225550.1 | energy coupling factor transporter S component ThiW | - |
| QML92_RS03215 (PC0780_06290) | - | 644257..645060 (+) | 804 | WP_001155185.1 | hydroxyethylthiazole kinase | - |
| QML92_RS03220 (PC0780_06300) | thiE | 645053..645685 (+) | 633 | WP_001078223.1 | thiamine phosphate synthase | - |
| QML92_RS03225 (PC0780_06310) | thiD | 645895..646686 (-) | 792 | WP_000221739.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| QML92_RS03230 (PC0780_06320) | - | 647052..647447 (+) | 396 | WP_001167216.1 | CopY/TcrY family copper transport repressor | - |
| QML92_RS03235 (PC0780_06330) | - | 647458..647829 (+) | 372 | WP_000935062.1 | cupredoxin domain-containing protein | - |
| QML92_RS03240 (PC0780_06340) | - | 647839..650082 (+) | 2244 | WP_000136321.1 | heavy metal translocating P-type ATPase | - |
| QML92_RS03245 (PC0780_06350) | spxB | 650289..652064 (+) | 1776 | WP_000191798.1 | pyruvate oxidase | - |
| QML92_RS03250 (PC0780_06360) | - | 652175..652522 (+) | 348 | WP_001052655.1 | VOC family protein | - |
| QML92_RS03255 | - | 652639..653512 (-) | 874 | Protein_647 | IS630 family transposase | - |
| QML92_RS03260 (PC0780_06390) | - | 653936..654256 (+) | 321 | Protein_648 | family 1 glycosylhydrolase | - |
| QML92_RS03265 (PC0780_06400) | manA | 654377..655321 (+) | 945 | WP_001294319.1 | mannose-6-phosphate isomerase, class I | - |
| QML92_RS03270 (PC0780_06410) | - | 655312..656809 (-) | 1498 | Protein_650 | sodium-dependent transporter | - |
| QML92_RS03275 (PC0780_06420) | - | 656892..657637 (+) | 746 | Protein_651 | MerR family transcriptional regulator | - |
| QML92_RS03280 (PC0780_06430) | - | 657666..658121 (-) | 456 | WP_001861299.1 | 8-oxo-dGTP diphosphatase | - |
| QML92_RS03285 (PC0780_06440) | - | 658141..659316 (-) | 1176 | WP_000680053.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QML92_RS03290 (PC0780_06450) | - | 659375..660220 (-) | 846 | WP_000219939.1 | DegV family protein | - |
| QML92_RS03295 (PC0780_06460) | - | 660345..660902 (+) | 558 | WP_000004139.1 | TetR/AcrR family transcriptional regulator | - |
| QML92_RS03300 (PC0780_06470) | - | 660921..661388 (+) | 468 | WP_000136976.1 | cytidine/deoxycytidylate deaminase family protein | - |
| QML92_RS03305 (PC0780_06480) | upp | 661477..662106 (+) | 630 | WP_000515974.1 | uracil phosphoribosyltransferase | - |
| QML92_RS03310 (PC0780_06490) | clpP | 662280..662870 (+) | 591 | WP_000613477.1 | ATP-dependent Clp protease proteolytic subunit ClpP | Regulator |
| QML92_RS03315 (PC0780_06500) | - | 662949..663197 (+) | 249 | WP_000462126.1 | YlbG family protein | - |
| QML92_RS03320 (PC0780_06510) | - | 663299..664459 (+) | 1161 | WP_000726146.1 | ABC transporter substrate-binding protein | - |
| QML92_RS03325 (PC0780_06520) | - | 664727..665596 (+) | 870 | WP_000941426.1 | branched-chain amino acid ABC transporter permease | - |
| QML92_RS03330 (PC0780_06530) | - | 665600..666556 (+) | 957 | WP_000662293.1 | branched-chain amino acid ABC transporter permease | - |
| QML92_RS03335 (PC0780_06540) | - | 666556..667320 (+) | 765 | WP_001186003.1 | ABC transporter ATP-binding protein | - |
| QML92_RS03340 (PC0780_06550) | - | 667320..668030 (+) | 711 | WP_000114808.1 | ABC transporter ATP-binding protein | - |
| QML92_RS03345 (PC0780_06560) | - | 668444..669100 (+) | 657 | WP_000268654.1 | CBS domain-containing protein | - |
| QML92_RS03350 (PC0780_06570) | prfB | 669208..670303 (+) | 1096 | WP_097556756.1 | peptide chain release factor 2 | - |
| QML92_RS03355 (PC0780_06580) | ftsE | 670321..671013 (+) | 693 | WP_000022268.1 | cell division ATP-binding protein FtsE | - |
| QML92_RS03360 (PC0780_06590) | ftsX | 671006..671932 (+) | 927 | WP_000625533.1 | permease-like cell division protein FtsX | - |
| QML92_RS03365 (PC0780_06600) | - | 672113..673066 (-) | 954 | WP_001155321.1 | IS30-like element ISSpn8 family transposase | - |
| QML92_RS03370 (PC0780_06610) | - | 673463..675643 (+) | 2181 | WP_000974066.1 | PTS transporter subunit IIBC | - |
| QML92_RS03375 (PC0780_06620) | - | 675695..676510 (+) | 816 | WP_000670838.1 | endonuclease/exonuclease/phosphatase family protein | - |
| QML92_RS03380 (PC0780_06630) | - | 676650..677993 (+) | 1344 | WP_000011015.1 | DEAD/DEAH box helicase | - |
| QML92_RS03385 (PC0780_06640) | metK | 678208..679398 (+) | 1191 | WP_000003935.1 | methionine adenosyltransferase | - |
| QML92_RS03390 (PC0780_06650) | - | 679951..680886 (+) | 936 | WP_000255160.1 | dihydroorotate oxidase | - |
| QML92_RS03395 (PC0780_06660) | holA | 680920..681957 (+) | 1038 | WP_000879657.1 | DNA polymerase III subunit delta | - |
| QML92_RS03400 (PC0780_06670) | sodA | 682130..682735 (+) | 606 | WP_000974746.1 | superoxide dismutase SodA | - |
| QML92_RS03405 (PC0780_06680) | - | 682891..683421 (+) | 531 | WP_001224352.1 | YutD family protein | - |
| QML92_RS03410 (PC0780_06690) | rlmN | 683442..684527 (+) | 1086 | WP_000804638.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QML92_RS03415 | - | 684527..685009 (+) | 483 | WP_000976706.1 | VanZ family protein | - |
| QML92_RS03420 (PC0780_06700) | - | 685011..686552 (+) | 1542 | WP_000025399.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| QML92_RS03425 (PC0780_06710) | - | 686609..687412 (-) | 804 | WP_000731920.1 | peptidylprolyl isomerase | - |
| QML92_RS03430 (PC0780_06720) | - | 687495..687707 (-) | 213 | WP_000011696.1 | hypothetical protein | - |
| QML92_RS03435 (PC0780_06730) | - | 688183..688392 (-) | 210 | WP_000953860.1 | hypothetical protein | - |
| QML92_RS03440 (PC0780_06740) | rpsP | 688562..688834 (+) | 273 | WP_000268761.1 | 30S ribosomal protein S16 | - |
| QML92_RS03445 (PC0780_06750) | kphA | 688854..689093 (+) | 240 | WP_000379621.1 | RNA-binding protein KphA | - |
| QML92_RS03450 | - | 689242..689566 (+) | 325 | Protein_686 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| QML92_RS03455 (PC0780_06760) | - | 689670..690458 (+) | 789 | WP_000819182.1 | alpha/beta hydrolase | - |
| QML92_RS03460 (PC0780_06770) | rimM | 690489..691007 (+) | 519 | WP_001105899.1 | ribosome maturation factor RimM | - |
| QML92_RS03465 (PC0780_06780) | trmD | 690997..691716 (+) | 720 | WP_000686921.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| QML92_RS03470 (PC0780_06790) | - | 691728..692066 (+) | 339 | WP_001196049.1 | ATP cone domain-containing protein | - |
| QML92_RS03475 (PC0780_06800) | - | 692096..692416 (-) | 321 | WP_001216108.1 | hypothetical protein | - |
| QML92_RS03480 (PC0780_06810) | - | 692514..692729 (+) | 216 | WP_000807422.1 | YdbC family protein | - |
| QML92_RS03485 | - | 692726..692872 (-) | 147 | WP_000692983.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 196 a.a. Molecular weight: 21358.36 Da Isoelectric Point: 4.4910
>NTDB_id=95265 QML92_RS03310 WP_000613477.1 662280..662870(+) (clpP) [Streptococcus pneumoniae strain PZ900700792]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQ
SMEKVHADAERDNWMSAQETLEYGFIDEIMANNSLN
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQ
SMEKVHADAERDNWMSAQETLEYGFIDEIMANNSLN
Nucleotide
Download Length: 591 bp
>NTDB_id=95265 QML92_RS03310 WP_000613477.1 662280..662870(+) (clpP) [Streptococcus pneumoniae strain PZ900700792]
ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCTTACGATATTTACTCACGTCTTCTCAAAGACCGCAT
CATTATGCTGACAGGTCCGGTTGAAGACAATATGGCTAACTCTGTTATTGCCCAATTGCTTTTCTTGGATGCCCAAGATA
GTACAAAAGATATTTACCTTTATGTCAATACACCAGGTGGTTCTGTTTCAGCTGGTTTGGCAATCGTAGATACCATGAAC
TTTATCAAGGCAGATGTCCAAACCATTGTTATGGGAATGGCTGCATCTATGGGGACTGTCATCGCATCAAGTGGGGCAAA
AGGCAAACGTTTCATGCTTCCAAATGCTGAATACATGATTCACCAACCAATGGGCGGTACAGGTGGTGGTACCCAACAAA
CTGATATGGCTATCGCTGCAGAACACTTGCTCAAAACTCGTAATACCTTGGAAAAAATCTTGGCTGAAAATTCAGGTCAG
TCAATGGAAAAAGTCCATGCAGATGCAGAACGTGATAACTGGATGAGCGCCCAGGAAACACTTGAATATGGCTTTATTGA
TGAAATTATGGCCAACAATTCATTGAACTAA
ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCTTACGATATTTACTCACGTCTTCTCAAAGACCGCAT
CATTATGCTGACAGGTCCGGTTGAAGACAATATGGCTAACTCTGTTATTGCCCAATTGCTTTTCTTGGATGCCCAAGATA
GTACAAAAGATATTTACCTTTATGTCAATACACCAGGTGGTTCTGTTTCAGCTGGTTTGGCAATCGTAGATACCATGAAC
TTTATCAAGGCAGATGTCCAAACCATTGTTATGGGAATGGCTGCATCTATGGGGACTGTCATCGCATCAAGTGGGGCAAA
AGGCAAACGTTTCATGCTTCCAAATGCTGAATACATGATTCACCAACCAATGGGCGGTACAGGTGGTGGTACCCAACAAA
CTGATATGGCTATCGCTGCAGAACACTTGCTCAAAACTCGTAATACCTTGGAAAAAATCTTGGCTGAAAATTCAGGTCAG
TCAATGGAAAAAGTCCATGCAGATGCAGAACGTGATAACTGGATGAGCGCCCAGGAAACACTTGAATATGGCTTTATTGA
TGAAATTATGGCCAACAATTCATTGAACTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| clpP | Streptococcus thermophilus LMG 18311 |
92.821 |
99.49 |
0.923 |
| clpP | Streptococcus thermophilus LMD-9 |
92.821 |
99.49 |
0.923 |
| clpP | Streptococcus pyogenes JRS4 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus pyogenes MGAS315 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus mutans UA159 |
85.714 |
100 |
0.857 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
85.128 |
99.49 |
0.847 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
84.615 |
99.49 |
0.842 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
58.854 |
97.959 |
0.577 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
58.031 |
98.469 |
0.571 |