Detailed information NTG0949049

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACG3JK_RS06915
• Genome accession: NZ_CP171738
• Coordinates: 1378721..1379041 (-)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain DB-M23
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1373721..1384041

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JK_RS06875 (ACG3JK_06875)	-	1374083..1374535 (-)	453	WP_003108634.1	hypothetical protein	-
ACG3JK_RS06880 (ACG3JK_06880)	-	1374528..1374740 (-)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JK_RS06885 (ACG3JK_06885)	-	1374851..1376044 (-)	1194	WP_003108638.1	acetate kinase	-
ACG3JK_RS06890 (ACG3JK_06890)	comGH	1376100..1377056 (-)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JK_RS06895 (ACG3JK_06895)	comGG	1377163..1377660 (-)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JK_RS06900 (ACG3JK_06900)	comGF/cglF	1377638..1378075 (-)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JK_RS06905 (ACG3JK_06905)	comGE	1378053..1378352 (-)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JK_RS06910 (ACG3JK_06910)	comGD	1378324..1378731 (-)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JK_RS06915 (ACG3JK_06915)	comGC	1378721..1379041 (-)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JK_RS06920 (ACG3JK_06920)	-	1379694..1380419 (-)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JK_RS06925 (ACG3JK_06925)	-	1380412..1380876 (-)	465	WP_013794399.1	phage holin family protein	-
ACG3JK_RS06930 (ACG3JK_06930)	-	1380880..1381029 (-)	150	WP_259966511.1	hypothetical protein	-
ACG3JK_RS06935 (ACG3JK_06935)	-	1381092..1381430 (-)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JK_RS06940 (ACG3JK_06940)	-	1381479..1383335 (-)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=949049 ACG3JK_RS06915 WP_013794397.1 1378721..1379041(-) (comGC) [Streptococcus parauberis strain DB-M23]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=949049 ACG3JK_RS06915 WP_013794397.1 1378721..1379041(-) (comGC) [Streptococcus parauberis strain DB-M23]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	55.556	93.396	0.519
comGC	Streptococcus mutans UA159	55.556	93.396	0.519
comGC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425