Detailed information NTG0948685

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACG3JI_RS09310
• Genome accession: NZ_CP171734
• Coordinates: 1823361..1823681 (+)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain DB-M9
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1818361..1828681

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JI_RS09285 (ACG3JI_09285)	-	1819067..1820923 (+)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-
ACG3JI_RS09290 (ACG3JI_09290)	-	1820972..1821310 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JI_RS09295 (ACG3JI_09295)	-	1821373..1821522 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JI_RS09300 (ACG3JI_09300)	-	1821526..1821990 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JI_RS09305 (ACG3JI_09305)	-	1821983..1822708 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JI_RS09310 (ACG3JI_09310)	comGC	1823361..1823681 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JI_RS09315 (ACG3JI_09315)	comGD	1823671..1824078 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JI_RS09320 (ACG3JI_09320)	comGE	1824050..1824349 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JI_RS09325 (ACG3JI_09325)	comGF/cglF	1824327..1824764 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JI_RS09330 (ACG3JI_09330)	comGG	1824793..1825239 (+)	447	WP_238570152.1	competence type IV pilus minor pilin ComGG	-
ACG3JI_RS09335 (ACG3JI_09335)	comGH	1825346..1826302 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JI_RS09340 (ACG3JI_09340)	-	1826358..1827551 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JI_RS09345 (ACG3JI_09345)	-	1827662..1827874 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JI_RS09350 (ACG3JI_09350)	-	1827867..1828319 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=948685 ACG3JI_RS09310 WP_013794397.1 1823361..1823681(+) (comGC) [Streptococcus parauberis strain DB-M9]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=948685 ACG3JI_RS09310 WP_013794397.1 1823361..1823681(+) (comGC) [Streptococcus parauberis strain DB-M9]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	55.556	93.396	0.519
comGC	Streptococcus mutans UA159	55.556	93.396	0.519
comGC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425