Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | WDV80_RS03595 | Genome accession | NZ_CP147733 |
| Coordinates | 759256..759444 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SagR272_TC | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 759900..768673 | 759256..759444 | flank | 456 |
| IS/Tn | 759900..760511 | 759256..759444 | flank | 456 |
Gene organization within MGE regions
Location: 759256..768673
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WDV80_RS03595 (WDV80_03595) | prx | 759256..759444 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| WDV80_RS03600 (WDV80_03600) | - | 759486..759686 (-) | 201 | WP_000076708.1 | CsbD family protein | - |
| WDV80_RS03605 (WDV80_03605) | - | 759864..760511 (+) | 648 | Protein_716 | IS3 family transposase | - |
| WDV80_RS03610 (WDV80_03610) | - | 760563..761882 (-) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| WDV80_RS03615 (WDV80_03615) | - | 761879..762532 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| WDV80_RS03620 (WDV80_03620) | - | 762629..764005 (-) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| WDV80_RS03625 (WDV80_03625) | - | 764005..764661 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| WDV80_RS03630 (WDV80_03630) | - | 764671..765948 (-) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| WDV80_RS03635 (WDV80_03635) | - | 766690..766851 (+) | 162 | WP_000508795.1 | NINE protein | - |
| WDV80_RS03640 (WDV80_03640) | - | 767024..768386 (-) | 1363 | Protein_723 | IS3 family transposase | - |
| WDV80_RS03645 (WDV80_03645) | - | 768407..768673 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=948363 WDV80_RS03595 WP_000027835.1 759256..759444(-) (prx) [Streptococcus agalactiae strain SagR272_TC]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=948363 WDV80_RS03595 WP_000027835.1 759256..759444(-) (prx) [Streptococcus agalactiae strain SagR272_TC]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |