Detailed information NTG0948289

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACG3JG_RS09730
• Genome accession: NZ_CP171730
• Coordinates: 1911151..1911471 (+)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain DB-WT
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1906151..1916471

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JG_RS09705 (ACG3JG_09705)	-	1906857..1908713 (+)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-
ACG3JG_RS09710 (ACG3JG_09710)	-	1908762..1909100 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JG_RS09715 (ACG3JG_09715)	-	1909163..1909312 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JG_RS09720 (ACG3JG_09720)	-	1909316..1909780 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JG_RS09725 (ACG3JG_09725)	-	1909773..1910498 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JG_RS09730 (ACG3JG_09730)	comGC	1911151..1911471 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JG_RS09735 (ACG3JG_09735)	comGD	1911461..1911868 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JG_RS09740 (ACG3JG_09740)	comGE	1911840..1912139 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JG_RS09745 (ACG3JG_09745)	comGF/cglF	1912117..1912554 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JG_RS09750 (ACG3JG_09750)	comGG	1912532..1913029 (+)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JG_RS09755 (ACG3JG_09755)	comGH	1913136..1914092 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JG_RS09760 (ACG3JG_09760)	-	1914148..1915341 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JG_RS09765 (ACG3JG_09765)	-	1915452..1915664 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JG_RS09770 (ACG3JG_09770)	-	1915657..1916109 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=948289 ACG3JG_RS09730 WP_013794397.1 1911151..1911471(+) (comGC) [Streptococcus parauberis strain DB-WT]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=948289 ACG3JG_RS09730 WP_013794397.1 1911151..1911471(+) (comGC) [Streptococcus parauberis strain DB-WT]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	55.556	93.396	0.519
comGC	Streptococcus mutans UA159	55.556	93.396	0.519
comGC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425