NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	V9W63_RS16215	Genome accession	NZ_CP146760
Coordinates	3309069..3309665 (+)	Length	198 a.a.
NCBI ID	WP_003151513.1	Uniprot ID	I2CAH7
Organism	Bacillus velezensis strain JJ334
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3304069..3314665

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V9W63_RS16190 (V9W63_16190)	-	3304079..3304390 (+)	312	WP_071182005.1	hypothetical protein	-
V9W63_RS16200 (V9W63_16200)	-	3304740..3306209 (-)	1470	WP_020956387.1	glycoside hydrolase family 32 protein	-
V9W63_RS16205 (V9W63_16205)	-	3306224..3307456 (-)	1233	WP_020956388.1	MFS transporter	-
V9W63_RS16210 (V9W63_16210)	-	3307847..3308821 (+)	975	WP_029325818.1	LacI family DNA-binding transcriptional regulator	-
V9W63_RS16215 (V9W63_16215)	clpP	3309069..3309665 (+)	597	WP_003151513.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
V9W63_RS16220 (V9W63_16220)	-	3309709..3310569 (-)	861	WP_003151510.1	LysR family transcriptional regulator	-
V9W63_RS16225 (V9W63_16225)	-	3310743..3311873 (+)	1131	WP_015418286.1	PrpF domain-containing protein	-
V9W63_RS16230 (V9W63_16230)	-	3311917..3313293 (+)	1377	WP_015240656.1	MFS transporter	-
V9W63_RS16235 (V9W63_16235)	-	3313537..3314112 (-)	576	WP_007407415.1	TIGR00730 family Rossman fold protein	-
V9W63_RS16240 (V9W63_16240)	-	3314228..3314548 (+)	321	WP_003151506.1	MazG-like family protein	-

Sequence

Protein

Download Length: 198 a.a. Molecular weight: 21831.06 Da Isoelectric Point: 4.6982

                                >NTDB_id=944334 V9W63_RS16215 WP_003151513.1 3309069..3309665(+) (clpP) [Bacillus velezensis strain JJ334]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSADEALEYGLIDKVLTRNTEDQK

Nucleotide

Download Length: 597 bp

                                >NTDB_id=944334 V9W63_RS16215 WP_003151513.1 3309069..3309665(+) (clpP) [Bacillus velezensis strain JJ334]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGAGAAAGAGCTTATGACATTTACTCCCGTCTTTTGAAGGA

CCGTATTATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCCTTGAAGCGG

AAGACCCTGAAAAAGATATTTCCATTTACATTAACAGCCCTGGCGGATCAATCACTGCCGGTATGGCAATCTATGATACA

ATGCAGTTCATTAAACCGAAAGTATCCACGATCTGCATCGGTATGGCCGCTTCTATGGGAGCATTTTTACTTGCAGCCGG

AGAAAAAGGCAAACGTTACGCGCTTCCTAACAGTGAAGTTATGATTCACCAGCCGCTTGGCGGAGCGCAAGGACAGGCGA

CAGAAATTGAAATCGCGGCAAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTGCTTGCTGAACGTACCGGCCAG

CCGCTTGAAGTCATTGAGCGCGATACAGACCGCGACAACTTCAAATCAGCTGATGAAGCCTTAGAATACGGCTTAATCGA

TAAAGTGCTGACACGCAATACAGAAGACCAGAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	I2CAH7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	95.96	100	0.96
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.586	96.465	0.662
clpP	Streptococcus thermophilus LMG 18311	58.549	97.475	0.571
clpP	Streptococcus thermophilus LMD-9	58.549	97.475	0.571
clpP	Streptococcus pneumoniae D39	57.216	97.98	0.561
clpP	Streptococcus pneumoniae Rx1	57.216	97.98	0.561
clpP	Streptococcus pneumoniae R6	57.216	97.98	0.561
clpP	Streptococcus pneumoniae TIGR4	57.216	97.98	0.561
clpP	Lactococcus lactis subsp. cremoris KW2	56.701	97.98	0.556
clpP	Streptococcus pyogenes JRS4	55.44	97.475	0.54
clpP	Streptococcus pyogenes MGAS315	55.44	97.475	0.54
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	54.639	97.98	0.535
clpP	Streptococcus mutans UA159	54.639	97.98	0.535

Detailed information NTG0944334