NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	V4331_RS02010	Genome accession	NZ_CP146743
Coordinates	401119..401718 (-)	Length	199 a.a.
NCBI ID	WP_003134020.1	Uniprot ID	-
Organism	Lactococcus formosensis subsp. formosensis strain L5
Function	degradation of ComX; degradation of ComW (predicted from homology) Competence regulation

Genomic Context

Location: 396119..406718

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V4331_RS02000 (V4331_02005)	-	396176..397399 (+)	1224	WP_096368654.1	FtsW/RodA/SpoVE family cell cycle protein	-
V4331_RS02005 (V4331_02010)	-	397600..401019 (+)	3420	WP_270264496.1	pyruvate carboxylase	-
V4331_RS02010 (V4331_02015)	clpP	401119..401718 (-)	600	WP_003134020.1	ATP-dependent Clp protease proteolytic subunit	Regulator
V4331_RS02015 (V4331_02020)	-	401897..402274 (+)	378	WP_096368652.1	VOC family protein	-
V4331_RS02020 (V4331_02025)	-	402334..402864 (+)	531	WP_017368814.1	hypothetical protein	-
V4331_RS02025 (V4331_02030)	spx	403025..403423 (+)	399	WP_003134024.1	transcriptional regulator Spx	-
V4331_RS02030 (V4331_02035)	-	403559..404332 (+)	774	WP_096368651.1	TatD family hydrolase	-
V4331_RS02035 (V4331_02040)	rnmV	404329..404874 (+)	546	WP_096368650.1	ribonuclease M5	-
V4331_RS02040 (V4331_02045)	-	404871..405794 (+)	924	WP_017368817.1	ABC transporter ATP-binding protein	-
V4331_RS02045 (V4331_02050)	-	405787..406557 (+)	771	WP_003134031.1	ABC transporter permease	-

Sequence

Protein

Download Length: 199 a.a. Molecular weight: 21787.90 Da Isoelectric Point: 4.7242

                                >NTDB_id=944005 V4331_RS02010 WP_003134020.1 401119..401718(-) (clpP) [Lactococcus formosensis subsp. formosensis strain L5]

MGYLVPTVIEQSSRGERAYDIYSRLLKDRIIMLTGQVEDGMANSIIAQLLFLDAQDSTKDIYLYINTPGGSVSAGLAIVD

TMNFIKSDVQTIVMGIAASMGTIIASSGTKGKRFMLPHAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRRTLEKILAEN

SGQSMEKVHADAERDNWMTAQETLDYGFIDEIMEANSLK

Nucleotide

Download Length: 600 bp

                                >NTDB_id=944005 V4331_RS02010 WP_003134020.1 401119..401718(-) (clpP) [Lactococcus formosensis subsp. formosensis strain L5]

ATGGGATATTTAGTACCTACTGTCATCGAGCAATCAAGCCGTGGTGAACGCGCATATGACATTTACAGCCGTCTACTGAA

GGACCGTATCATCATGTTGACAGGCCAAGTTGAGGATGGTATGGCCAACTCAATCATCGCACAACTCCTCTTCTTGGATG

CCCAAGACAGCACAAAGGACATTTACCTCTATATTAATACACCTGGTGGTTCTGTATCTGCTGGACTTGCGATTGTAGAT

ACCATGAACTTCATCAAGTCTGATGTTCAAACAATCGTTATGGGTATCGCTGCATCTATGGGTACAATCATTGCTTCTAG

TGGTACAAAAGGTAAACGTTTCATGTTGCCACATGCAGAATACATGATTCACCAACCTATGGGAGGTACTGGTGGCGGCA

CACAACAAACAGATATGGCTATTGCTGCGGAACATTTGCTTAAAACACGTCGTACTTTAGAAAAGATTTTGGCAGAAAAC

TCTGGTCAATCTATGGAAAAAGTACATGCCGATGCAGAACGTGATAACTGGATGACTGCACAAGAAACATTAGACTATGG

TTTCATTGATGAAATCATGGAAGCCAACAGCTTGAAATAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(14-195)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Streptococcus pneumoniae Rx1	89.796	98.492	0.884
clpP	Streptococcus pneumoniae D39	89.796	98.492	0.884
clpP	Streptococcus pneumoniae R6	89.796	98.492	0.884
clpP	Streptococcus pneumoniae TIGR4	89.796	98.492	0.884
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	87.94	100	0.879
clpP	Lactococcus lactis subsp. cremoris KW2	87.437	100	0.874
clpP	Streptococcus thermophilus LMG 18311	87.755	98.492	0.864
clpP	Streptococcus thermophilus LMD-9	87.755	98.492	0.864
clpP	Streptococcus pyogenes JRS4	84.184	98.492	0.829
clpP	Streptococcus pyogenes MGAS315	84.184	98.492	0.829
clpP	Streptococcus mutans UA159	84.184	98.492	0.829
clpP	Bacillus subtilis subsp. subtilis str. 168	58.421	95.477	0.558
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	56.995	96.985	0.553

Detailed information NTG0944005