Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | V6U67_RS09750 | Genome accession | NZ_CP145865 |
| Coordinates | 2086921..2087109 (-) | Length | 62 a.a. |
| NCBI ID | WP_410531180.1 | Uniprot ID | - |
| Organism | Streptococcus salivarius strain KSS8 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2065504..2093640 | 2086921..2087109 | within | 0 |
Gene organization within MGE regions
Location: 2065504..2093640
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6U67_RS09630 (V6U67_09630) | - | 2065504..2065758 (-) | 255 | WP_129852295.1 | hypothetical protein | - |
| V6U67_RS09635 (V6U67_09635) | - | 2065818..2066166 (-) | 349 | Protein_1839 | diacylglycerol kinase family lipid kinase | - |
| V6U67_RS09640 (V6U67_09640) | - | 2066168..2066311 (-) | 144 | Protein_1840 | IS982 family transposase | - |
| V6U67_RS09645 (V6U67_09645) | - | 2066663..2067271 (+) | 609 | WP_129852297.1 | DUF1269 domain-containing protein | - |
| V6U67_RS09650 (V6U67_09650) | - | 2067513..2067683 (+) | 171 | Protein_1842 | tyrosine-type recombinase/integrase | - |
| V6U67_RS09655 (V6U67_09655) | - | 2068306..2069502 (+) | 1197 | Protein_1843 | tyrosine-type recombinase/integrase | - |
| V6U67_RS09660 (V6U67_09660) | - | 2069937..2071391 (+) | 1455 | Protein_1844 | IS1182 family transposase | - |
| V6U67_RS09665 (V6U67_09665) | - | 2072221..2072648 (+) | 428 | Protein_1845 | UDP-N-acetylglucosamine 2-epimerase | - |
| V6U67_RS09670 (V6U67_09670) | - | 2072622..2073004 (+) | 383 | Protein_1846 | UDP-N-acetylglucosamine 2-epimerase | - |
| V6U67_RS09675 (V6U67_09675) | - | 2073034..2073267 (+) | 234 | Protein_1847 | PfkB family carbohydrate kinase | - |
| V6U67_RS09680 (V6U67_09680) | - | 2073289..2074323 (+) | 1035 | WP_022496166.1 | GGDEF domain-containing protein | - |
| V6U67_RS09685 (V6U67_09685) | - | 2074320..2075384 (+) | 1065 | WP_037601258.1 | bifunctional glycosyltransferase family 2/GtrA family protein | - |
| V6U67_RS09690 (V6U67_09690) | - | 2075374..2077599 (+) | 2226 | WP_022496165.1 | glycosyltransferase family 2 protein | - |
| V6U67_RS09695 (V6U67_09695) | - | 2077596..2079536 (+) | 1941 | WP_022496164.1 | hypothetical protein | - |
| V6U67_RS09700 (V6U67_09700) | - | 2079649..2079840 (-) | 192 | Protein_1852 | DNA polymerase | - |
| V6U67_RS09705 (V6U67_09705) | - | 2080168..2080788 (+) | 621 | WP_022496163.1 | hypothetical protein | - |
| V6U67_RS09710 (V6U67_09710) | - | 2080821..2081099 (+) | 279 | WP_022496162.1 | hypothetical protein | - |
| V6U67_RS09715 (V6U67_09715) | - | 2081101..2081892 (+) | 792 | WP_022496161.1 | hypothetical protein | - |
| V6U67_RS09720 (V6U67_09720) | - | 2081867..2082367 (+) | 501 | WP_022496160.1 | hypothetical protein | - |
| V6U67_RS09725 (V6U67_09725) | - | 2082597..2082686 (-) | 90 | Protein_1857 | CoA pyrophosphatase | - |
| V6U67_RS09730 (V6U67_09730) | - | 2082743..2085112 (-) | 2370 | WP_022496155.1 | YhgE/Pip domain-containing protein | - |
| V6U67_RS09735 (V6U67_09735) | - | 2085241..2085780 (+) | 540 | WP_002885702.1 | TetR/AcrR family transcriptional regulator | - |
| V6U67_RS09740 (V6U67_09740) | - | 2085857..2086219 (-) | 363 | WP_022496154.1 | DUF1304 domain-containing protein | - |
| V6U67_RS09745 (V6U67_09745) | - | 2086335..2086523 (+) | 189 | WP_002885644.1 | hypothetical protein | - |
| V6U67_RS09750 (V6U67_09750) | prx | 2086921..2087109 (-) | 189 | WP_410531180.1 | hypothetical protein | Regulator |
| V6U67_RS09755 (V6U67_09755) | - | 2087385..2087822 (-) | 438 | WP_410531181.1 | hypothetical protein | - |
| V6U67_RS09760 (V6U67_09760) | - | 2088055..2088318 (-) | 264 | WP_410531182.1 | hypothetical protein | - |
| V6U67_RS09765 (V6U67_09765) | - | 2088315..2088512 (-) | 198 | WP_410531183.1 | DUF2758 domain-containing protein | - |
| V6U67_RS09770 (V6U67_09770) | - | 2088838..2090250 (-) | 1413 | WP_410531303.1 | VapE domain-containing protein | - |
| V6U67_RS09775 (V6U67_09775) | - | 2090247..2091104 (-) | 858 | WP_410531184.1 | primase alpha helix C-terminal domain-containing protein | - |
| V6U67_RS09780 (V6U67_09780) | - | 2091121..2091393 (-) | 273 | WP_195320566.1 | MerR family transcriptional regulator | - |
| V6U67_RS09785 (V6U67_09785) | - | 2091380..2091736 (-) | 357 | WP_410531185.1 | hypothetical protein | - |
| V6U67_RS09790 (V6U67_09790) | - | 2091723..2091968 (-) | 246 | WP_410531186.1 | hypothetical protein | - |
| V6U67_RS09795 (V6U67_09795) | - | 2091982..2092188 (-) | 207 | WP_410531187.1 | hypothetical protein | - |
| V6U67_RS09800 (V6U67_09800) | - | 2092192..2092494 (-) | 303 | WP_347093488.1 | hypothetical protein | - |
| V6U67_RS09805 (V6U67_09805) | - | 2092720..2092917 (-) | 198 | WP_183139963.1 | helix-turn-helix transcriptional regulator | - |
| V6U67_RS09810 (V6U67_09810) | - | 2093074..2093640 (+) | 567 | WP_410531188.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7113.94 Da Isoelectric Point: 4.3304
>NTDB_id=940681 V6U67_RS09750 WP_410531180.1 2086921..2087109(-) (prx) [Streptococcus salivarius strain KSS8]
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVESHETLSLEKVSDIIKELGEDN
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVESHETLSLEKVSDIIKELGEDN
Nucleotide
Download Length: 189 bp
>NTDB_id=940681 V6U67_RS09750 WP_410531180.1 2086921..2087109(-) (prx) [Streptococcus salivarius strain KSS8]
ATGCTAACCTATGATGAATTTAAAGAGGCTATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATAGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGTCACACGAAACATTGAGTTTAGAAAAGGTATCGGATA
TAATAAAGGAACTAGGCGAGGACAACTAA
ATGCTAACCTATGATGAATTTAAAGAGGCTATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATAGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGTCACACGAAACATTGAGTTTAGAAAAGGTATCGGATA
TAATAAAGGAACTAGGCGAGGACAACTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
55.932 |
95.161 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
67.742 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
66.129 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
67.742 |
0.452 |