NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	V6Z34_RS17595	Genome accession	NZ_CP145817
Coordinates	3513592..3514188 (+)	Length	198 a.a.
NCBI ID	WP_003151513.1	Uniprot ID	I2CAH7
Organism	Bacillus velezensis strain WH-7
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3508592..3519188

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6Z34_RS17570	-	3508611..3508922 (+)	312	WP_003151521.1	hypothetical protein	-
V6Z34_RS17580	-	3509271..3510734 (-)	1464	WP_024085836.1	glycoside hydrolase family 32 protein	-
V6Z34_RS17585	-	3510749..3511981 (-)	1233	WP_276123540.1	MFS transporter	-
V6Z34_RS17590	-	3512371..3513344 (+)	974	Protein_3403	LacI family DNA-binding transcriptional regulator	-
V6Z34_RS17595	clpP	3513592..3514188 (+)	597	WP_003151513.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
V6Z34_RS17600	-	3514232..3515092 (-)	861	WP_003151510.1	LysR family transcriptional regulator	-
V6Z34_RS17605	-	3515266..3516396 (+)	1131	WP_276123541.1	2-methylaconitate cis-trans isomerase PrpF family protein	-
V6Z34_RS17610	-	3516439..3517815 (+)	1377	WP_014305894.1	MFS transporter	-
V6Z34_RS17615	-	3518024..3518599 (-)	576	WP_015387658.1	TIGR00730 family Rossman fold protein	-
V6Z34_RS17620	-	3518715..3519035 (+)	321	WP_003151506.1	MazG nucleotide pyrophosphohydrolase domain-containing protein	-

Sequence

Protein

Download Length: 198 a.a. Molecular weight: 21831.06 Da Isoelectric Point: 4.6982

                                >NTDB_id=940125 V6Z34_RS17595 WP_003151513.1 3513592..3514188(+) (clpP) [Bacillus velezensis strain WH-7]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSADEALEYGLIDKVLTRNTEDQK

Nucleotide

Download Length: 597 bp

                                >NTDB_id=940125 V6Z34_RS17595 WP_003151513.1 3513592..3514188(+) (clpP) [Bacillus velezensis strain WH-7]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGAGAAAGAGCTTATGACATTTACTCCCGTCTTTTGAAGGA

CCGTATTATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCCTTGAAGCGG

AAGACCCTGAAAAAGATATTTCCATTTACATTAACAGCCCTGGCGGATCAATCACTGCCGGTATGGCAATCTATGATACA

ATGCAGTTCATTAAACCGAAAGTATCCACGATCTGCATCGGTATGGCCGCTTCTATGGGAGCATTTTTACTTGCAGCCGG

AGAAAAAGGCAAACGTTACGCGCTTCCTAACAGTGAAGTTATGATTCACCAGCCGCTTGGCGGAGCGCAAGGACAGGCGA

CAGAAATTGAAATTGCGGCAAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTGCTTGCTGAACGTACCGGCCAG

CCGCTTGAAGTCATTGAGCGCGATACAGACCGCGACAACTTCAAATCAGCTGATGAAGCCTTAGAATACGGCTTAATCGA

TAAAGTGCTGACACGCAATACGGAAGACCAGAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	I2CAH7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	95.96	100	0.96
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.586	96.465	0.662
clpP	Streptococcus thermophilus LMG 18311	58.549	97.475	0.571
clpP	Streptococcus thermophilus LMD-9	58.549	97.475	0.571
clpP	Streptococcus pneumoniae D39	57.216	97.98	0.561
clpP	Streptococcus pneumoniae Rx1	57.216	97.98	0.561
clpP	Streptococcus pneumoniae R6	57.216	97.98	0.561
clpP	Streptococcus pneumoniae TIGR4	57.216	97.98	0.561
clpP	Lactococcus lactis subsp. cremoris KW2	56.701	97.98	0.556
clpP	Streptococcus pyogenes JRS4	55.44	97.475	0.54
clpP	Streptococcus pyogenes MGAS315	55.44	97.475	0.54
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	54.639	97.98	0.535
clpP	Streptococcus mutans UA159	54.639	97.98	0.535

Detailed information NTG0940125