Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ACD269_RS02590 | Genome accession | NZ_CP168260 |
| Coordinates | 497832..497981 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain FC2 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 492832..502981
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACD269_RS02540 (ACD269_02540) | blpI | 492867..493064 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| ACD269_RS02545 (ACD269_02545) | blpJ | 493531..493800 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| ACD269_RS02550 (ACD269_02550) | blpU | 493869..494099 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| ACD269_RS02555 (ACD269_02555) | - | 494102..494221 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| ACD269_RS02560 (ACD269_02560) | - | 494518..494682 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| ACD269_RS02565 (ACD269_02565) | - | 494679..495083 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| ACD269_RS02570 (ACD269_02570) | - | 495184..495998 (+) | 815 | Protein_505 | IS5-like element IS1515 family transposase | - |
| ACD269_RS02575 (ACD269_02575) | - | 496159..496965 (+) | 807 | Protein_506 | IS5 family transposase | - |
| ACD269_RS02580 (ACD269_02580) | blpM | 497115..497369 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| ACD269_RS02585 (ACD269_02585) | blpN | 497385..497588 (+) | 204 | WP_001099491.1 | two-peptide bacteriocin subunit BlpN | - |
| ACD269_RS02590 (ACD269_02590) | cipB | 497832..497981 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| ACD269_RS02595 (ACD269_02595) | - | 498085..498204 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ACD269_RS02600 (ACD269_02600) | - | 498990..499373 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| ACD269_RS02605 (ACD269_02605) | - | 499425..500114 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACD269_RS02610 (ACD269_02610) | blpZ | 500156..500404 (+) | 249 | WP_000276509.1 | immunity protein BlpZ | - |
| ACD269_RS02615 (ACD269_02615) | - | 500434..501045 (+) | 612 | WP_000394040.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACD269_RS02620 (ACD269_02620) | ccrZ | 501207..502001 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ACD269_RS02625 (ACD269_02625) | trmB | 501998..502633 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=935201 ACD269_RS02590 WP_001818346.1 497832..497981(+) (cipB) [Streptococcus pneumoniae strain FC2]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=935201 ACD269_RS02590 WP_001818346.1 497832..497981(+) (cipB) [Streptococcus pneumoniae strain FC2]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |