Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP34_RS03080 | Genome accession | NZ_CP142358 |
| Coordinates | 583702..583890 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain 6702-99 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 537523..586719 | 583702..583890 | within | 0 |
Gene organization within MGE regions
Location: 537523..586719
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP34_RS02780 (VKP34_02780) | - | 537523..538464 (-) | 942 | WP_002985305.1 | DHH family phosphoesterase | - |
| VKP34_RS02785 (VKP34_02785) | - | 538858..539307 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| VKP34_RS02790 (VKP34_02790) | - | 539482..539766 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| VKP34_RS02795 (VKP34_02795) | - | 539759..541021 (+) | 1263 | WP_014635376.1 | voltage-gated chloride channel family protein | - |
| VKP34_RS02800 (VKP34_02800) | rplS | 541136..541483 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| VKP34_RS02810 (VKP34_02810) | - | 541848..542924 (-) | 1077 | WP_111685702.1 | tyrosine-type recombinase/integrase | - |
| VKP34_RS02815 (VKP34_02815) | - | 543043..543564 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| VKP34_RS02820 (VKP34_02820) | - | 543575..543952 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VKP34_RS02825 (VKP34_02825) | - | 543936..544295 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| VKP34_RS02830 (VKP34_02830) | - | 544483..544701 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| VKP34_RS02835 (VKP34_02835) | - | 544801..545031 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| VKP34_RS02840 (VKP34_02840) | - | 545015..545158 (+) | 144 | WP_164492191.1 | hypothetical protein | - |
| VKP34_RS02845 (VKP34_02845) | - | 545168..545386 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| VKP34_RS02850 (VKP34_02850) | - | 545388..545630 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| VKP34_RS02855 (VKP34_02855) | - | 545614..546933 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| VKP34_RS02860 (VKP34_02860) | - | 546948..548030 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| VKP34_RS02865 (VKP34_02865) | - | 548069..548203 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| VKP34_RS02870 (VKP34_02870) | - | 548225..548818 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| VKP34_RS02875 (VKP34_02875) | - | 548818..550401 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| VKP34_RS02880 (VKP34_02880) | - | 550414..550608 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| VKP34_RS02885 (VKP34_02885) | - | 550631..552874 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| VKP34_RS02890 (VKP34_02890) | - | 553166..553348 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| VKP34_RS02895 (VKP34_02895) | - | 553341..553736 (+) | 396 | WP_111685703.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VKP34_RS02900 (VKP34_02900) | - | 553733..553954 (+) | 222 | WP_010922069.1 | hypothetical protein | - |
| VKP34_RS02905 (VKP34_02905) | - | 553957..554229 (+) | 273 | WP_019418812.1 | hypothetical protein | - |
| VKP34_RS02910 (VKP34_02910) | - | 554233..554715 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| VKP34_RS02915 (VKP34_02915) | - | 554705..555469 (+) | 765 | WP_021299463.1 | DNA-methyltransferase | - |
| VKP34_RS02920 (VKP34_02920) | - | 555560..555853 (+) | 294 | WP_111685705.1 | hypothetical protein | - |
| VKP34_RS02925 (VKP34_02925) | - | 556309..556746 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| VKP34_RS02930 (VKP34_02930) | - | 557080..558246 (+) | 1167 | WP_136114857.1 | DNA modification methylase | - |
| VKP34_RS02935 (VKP34_02935) | - | 558589..559065 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| VKP34_RS02940 (VKP34_02940) | - | 559148..560359 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| VKP34_RS02945 (VKP34_02945) | - | 560373..561875 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| VKP34_RS02950 (VKP34_02950) | - | 561880..563373 (+) | 1494 | WP_010922076.1 | phage minor capsid protein | - |
| VKP34_RS02955 (VKP34_02955) | - | 563373..563600 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| VKP34_RS02960 (VKP34_02960) | - | 563687..563953 (+) | 267 | WP_010922078.1 | hypothetical protein | - |
| VKP34_RS02965 (VKP34_02965) | - | 564079..564693 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| VKP34_RS02970 (VKP34_02970) | - | 564697..565515 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| VKP34_RS02975 (VKP34_02975) | - | 565569..565985 (+) | 417 | WP_111685706.1 | hypothetical protein | - |
| VKP34_RS02980 (VKP34_02980) | - | 565975..566307 (+) | 333 | WP_111685707.1 | minor capsid protein | - |
| VKP34_RS02985 (VKP34_02985) | - | 566307..566663 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| VKP34_RS02990 (VKP34_02990) | - | 566660..567058 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| VKP34_RS02995 (VKP34_02995) | - | 567058..567543 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| VKP34_RS03000 (VKP34_03000) | - | 567582..568016 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| VKP34_RS03005 (VKP34_03005) | - | 568020..568601 (+) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| VKP34_RS03010 (VKP34_03010) | - | 568591..571851 (+) | 3261 | WP_030126579.1 | tape measure protein | - |
| VKP34_RS03015 (VKP34_03015) | - | 571848..572564 (+) | 717 | WP_111685708.1 | distal tail protein Dit | - |
| VKP34_RS03020 (VKP34_03020) | - | 572561..574705 (+) | 2145 | WP_021775334.1 | phage tail spike protein | - |
| VKP34_RS03025 (VKP34_03025) | hylP | 574702..575724 (+) | 1023 | WP_020837648.1 | hyaluronidase HylP | - |
| VKP34_RS03030 (VKP34_03030) | - | 575737..577620 (+) | 1884 | WP_136114856.1 | gp58-like family protein | - |
| VKP34_RS03035 (VKP34_03035) | - | 577632..578063 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| VKP34_RS03040 (VKP34_03040) | - | 578066..578683 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| VKP34_RS03045 (VKP34_03045) | - | 578693..578968 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| VKP34_RS03050 (VKP34_03050) | - | 578965..579192 (+) | 228 | WP_136059203.1 | phage holin | - |
| VKP34_RS03055 (VKP34_03055) | - | 579308..580513 (+) | 1206 | WP_136059204.1 | glucosaminidase domain-containing protein | - |
| VKP34_RS03060 (VKP34_03060) | - | 580662..580826 (+) | 165 | WP_021340366.1 | hypothetical protein | - |
| VKP34_RS03065 (VKP34_03065) | - | 580859..581419 (+) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| VKP34_RS03070 (VKP34_03070) | spem | 581803..582516 (+) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| VKP34_RS03075 (VKP34_03075) | spel | 582799..583587 (+) | 789 | WP_136059205.1 | streptococcal pyrogenic exotoxin SpeL | - |
| VKP34_RS03080 (VKP34_03080) | prx | 583702..583890 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| VKP34_RS03090 (VKP34_03090) | - | 584481..585095 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| VKP34_RS03095 (VKP34_03095) | - | 585226..586011 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| VKP34_RS03100 (VKP34_03100) | - | 586021..586719 (-) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=925432 VKP34_RS03080 WP_011054546.1 583702..583890(+) (prx) [Streptococcus pyogenes strain 6702-99]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=925432 VKP34_RS03080 WP_011054546.1 583702..583890(+) (prx) [Streptococcus pyogenes strain 6702-99]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTACGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTACGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |