Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP36_RS05710 | Genome accession | NZ_CP142357 |
| Coordinates | 1140052..1140234 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain AW-534 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1140052..1176397 | 1140052..1140234 | within | 0 |
Gene organization within MGE regions
Location: 1140052..1176397
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP36_RS05710 (VKP36_05710) | prx | 1140052..1140234 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| VKP36_RS05715 (VKP36_05715) | mf2 | 1140474..1141232 (+) | 759 | WP_014635573.1 | DNase Mf2 | - |
| VKP36_RS05720 (VKP36_05720) | speC | 1141343..1142050 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VKP36_RS05725 (VKP36_05725) | - | 1142119..1143336 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| VKP36_RS05730 (VKP36_05730) | - | 1143455..1143682 (-) | 228 | WP_003058873.1 | phage holin | - |
| VKP36_RS05735 (VKP36_05735) | - | 1143679..1143951 (-) | 273 | WP_019418840.1 | hypothetical protein | - |
| VKP36_RS05740 (VKP36_05740) | - | 1143961..1144578 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| VKP36_RS05745 (VKP36_05745) | - | 1144581..1145012 (-) | 432 | WP_136107654.1 | DUF1617 family protein | - |
| VKP36_RS05750 (VKP36_05750) | - | 1145021..1146802 (-) | 1782 | WP_136110606.1 | gp58-like family protein | - |
| VKP36_RS05755 (VKP36_05755) | - | 1146817..1147926 (-) | 1110 | WP_136094931.1 | hyaluronoglucosaminidase | - |
| VKP36_RS05760 (VKP36_05760) | - | 1147926..1149884 (-) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| VKP36_RS05765 (VKP36_05765) | - | 1149881..1150576 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| VKP36_RS05770 (VKP36_05770) | - | 1150573..1152930 (-) | 2358 | WP_326624389.1 | hypothetical protein | - |
| VKP36_RS05775 (VKP36_05775) | - | 1152930..1153301 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| VKP36_RS05780 (VKP36_05780) | - | 1153316..1153579 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| VKP36_RS05785 (VKP36_05785) | - | 1153590..1154180 (-) | 591 | WP_053308478.1 | hypothetical protein | - |
| VKP36_RS05790 (VKP36_05790) | - | 1154196..1154531 (-) | 336 | WP_326624391.1 | hypothetical protein | - |
| VKP36_RS05795 (VKP36_05795) | - | 1154532..1154768 (-) | 237 | WP_053308479.1 | hypothetical protein | - |
| VKP36_RS05800 (VKP36_05800) | - | 1154761..1155099 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| VKP36_RS05805 (VKP36_05805) | - | 1155059..1155481 (-) | 423 | WP_136107615.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP36_RS05810 (VKP36_05810) | - | 1155495..1155710 (-) | 216 | WP_136107616.1 | hypothetical protein | - |
| VKP36_RS05815 (VKP36_05815) | - | 1155707..1156609 (-) | 903 | WP_000841023.1 | phage major capsid protein | - |
| VKP36_RS05820 (VKP36_05820) | - | 1156612..1157076 (-) | 465 | WP_136107618.1 | DUF4355 domain-containing protein | - |
| VKP36_RS05825 (VKP36_05825) | - | 1157157..1158572 (-) | 1416 | WP_011054685.1 | terminase | - |
| VKP36_RS05830 (VKP36_05830) | - | 1158654..1158890 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| VKP36_RS05835 (VKP36_05835) | - | 1158892..1159158 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| VKP36_RS05840 (VKP36_05840) | - | 1159151..1159330 (-) | 180 | WP_032461150.1 | hypothetical protein | - |
| VKP36_RS05845 (VKP36_05845) | - | 1159380..1159604 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| VKP36_RS05850 (VKP36_05850) | - | 1159610..1161103 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| VKP36_RS05855 (VKP36_05855) | - | 1161096..1162364 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| VKP36_RS05860 (VKP36_05860) | - | 1162361..1162717 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| VKP36_RS05865 (VKP36_05865) | - | 1162867..1163211 (-) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| VKP36_RS05870 (VKP36_05870) | - | 1163318..1163737 (-) | 420 | WP_111684753.1 | DUF1492 domain-containing protein | - |
| VKP36_RS05875 (VKP36_05875) | - | 1164168..1164488 (-) | 321 | WP_326624403.1 | hypothetical protein | - |
| VKP36_RS05880 (VKP36_05880) | - | 1164478..1164834 (-) | 357 | WP_227877584.1 | DNA cytosine methyltransferase | - |
| VKP36_RS05885 (VKP36_05885) | - | 1164818..1165609 (-) | 792 | WP_168625317.1 | DNA cytosine methyltransferase | - |
| VKP36_RS05890 (VKP36_05890) | - | 1165611..1165880 (-) | 270 | WP_136107620.1 | hypothetical protein | - |
| VKP36_RS05895 (VKP36_05895) | - | 1165885..1166070 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| VKP36_RS05900 (VKP36_05900) | - | 1166057..1166569 (-) | 513 | WP_326624412.1 | hypothetical protein | - |
| VKP36_RS05905 (VKP36_05905) | - | 1166566..1166907 (-) | 342 | WP_000435056.1 | hypothetical protein | - |
| VKP36_RS05910 (VKP36_05910) | - | 1167103..1168131 (-) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| VKP36_RS05915 (VKP36_05915) | bet | 1168141..1168932 (-) | 792 | WP_136095090.1 | phage recombination protein Bet | - |
| VKP36_RS05920 (VKP36_05920) | - | 1168935..1169264 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| VKP36_RS05925 (VKP36_05925) | - | 1169320..1169526 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| VKP36_RS05930 (VKP36_05930) | - | 1169535..1169675 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| VKP36_RS05935 (VKP36_05935) | - | 1169672..1169905 (-) | 234 | WP_326624421.1 | hypothetical protein | - |
| VKP36_RS05940 (VKP36_05940) | - | 1169886..1170272 (-) | 387 | WP_326624423.1 | DnaD domain-containing protein | - |
| VKP36_RS05945 (VKP36_05945) | - | 1170413..1170682 (-) | 270 | WP_011106700.1 | replication protein | - |
| VKP36_RS05950 (VKP36_05950) | - | 1170776..1170961 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| VKP36_RS05955 (VKP36_05955) | - | 1170963..1171274 (-) | 312 | WP_010922478.1 | excisionase | - |
| VKP36_RS05960 (VKP36_05960) | - | 1171544..1171756 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP36_RS05965 (VKP36_05965) | - | 1171958..1172713 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP36_RS05970 (VKP36_05970) | - | 1172725..1173243 (+) | 519 | WP_326624426.1 | HIRAN domain-containing protein | - |
| VKP36_RS05975 (VKP36_05975) | - | 1173367..1174509 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| VKP36_RS05980 (VKP36_05980) | - | 1174598..1174873 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP36_RS05985 (VKP36_05985) | - | 1174972..1175559 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| VKP36_RS05990 (VKP36_05990) | - | 1175537..1176379 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=925385 VKP36_RS05710 WP_014635572.1 1140052..1140234(-) (prx) [Streptococcus pyogenes strain AW-534]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925385 VKP36_RS05710 WP_014635572.1 1140052..1140234(-) (prx) [Streptococcus pyogenes strain AW-534]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |