Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP36_RS04830 | Genome accession | NZ_CP142357 |
| Coordinates | 973535..973723 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain AW-534 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 965940..1021691 | 973535..973723 | within | 0 |
Gene organization within MGE regions
Location: 965940..1021691
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP36_RS04795 (VKP36_04795) | pfkA | 965940..966953 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| VKP36_RS04800 (VKP36_04800) | - | 967033..970143 (-) | 3111 | WP_136263433.1 | DNA polymerase III subunit alpha | - |
| VKP36_RS04805 (VKP36_04805) | - | 970328..970699 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| VKP36_RS04810 (VKP36_04810) | - | 970699..971397 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| VKP36_RS04815 (VKP36_04815) | - | 971407..972192 (+) | 786 | WP_053308385.1 | hypothetical protein | - |
| VKP36_RS04820 (VKP36_04820) | - | 972330..972944 (-) | 615 | WP_326624234.1 | TVP38/TMEM64 family protein | - |
| VKP36_RS04830 (VKP36_04830) | prx | 973535..973723 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| VKP36_RS04835 (VKP36_04835) | spel | 973838..974626 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| VKP36_RS04840 (VKP36_04840) | spem | 974908..975621 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| VKP36_RS04845 (VKP36_04845) | - | 975977..977182 (-) | 1206 | WP_136115266.1 | Fic family protein | - |
| VKP36_RS04850 (VKP36_04850) | - | 977367..978575 (-) | 1209 | WP_326624238.1 | glucosaminidase domain-containing protein | - |
| VKP36_RS04855 (VKP36_04855) | - | 978691..978918 (-) | 228 | WP_085577373.1 | phage holin | - |
| VKP36_RS04860 (VKP36_04860) | - | 978915..979190 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| VKP36_RS04865 (VKP36_04865) | - | 979200..979817 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| VKP36_RS04870 (VKP36_04870) | - | 979820..980251 (-) | 432 | WP_136107654.1 | DUF1617 family protein | - |
| VKP36_RS04875 (VKP36_04875) | - | 980260..982164 (-) | 1905 | WP_326624242.1 | gp58-like family protein | - |
| VKP36_RS04880 (VKP36_04880) | hylP | 982177..983196 (-) | 1020 | WP_326624244.1 | hyaluronidase HylP | - |
| VKP36_RS04885 (VKP36_04885) | - | 983196..985244 (-) | 2049 | WP_326624246.1 | phage tail spike protein | - |
| VKP36_RS04890 (VKP36_04890) | - | 985241..986020 (-) | 780 | WP_032462880.1 | distal tail protein Dit | - |
| VKP36_RS04895 (VKP36_04895) | - | 986052..989687 (-) | 3636 | WP_326624248.1 | tape measure protein | - |
| VKP36_RS04900 (VKP36_04900) | - | 989702..990031 (-) | 330 | WP_002988428.1 | hypothetical protein | - |
| VKP36_RS04905 (VKP36_04905) | - | 990073..990432 (-) | 360 | WP_023078288.1 | tail assembly chaperone | - |
| VKP36_RS04910 (VKP36_04910) | - | 990492..991061 (-) | 570 | WP_080276904.1 | phage major tail protein, TP901-1 family | - |
| VKP36_RS04915 (VKP36_04915) | - | 991116..991505 (-) | 390 | WP_032461958.1 | phage capsid protein | - |
| VKP36_RS04920 (VKP36_04920) | - | 991502..991867 (-) | 366 | WP_326624254.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VKP36_RS04925 (VKP36_04925) | - | 991848..992156 (-) | 309 | WP_136106206.1 | hypothetical protein | - |
| VKP36_RS04930 (VKP36_04930) | - | 992153..992506 (-) | 354 | WP_111688467.1 | phage head-tail connector protein | - |
| VKP36_RS04935 (VKP36_04935) | - | 992520..992762 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| VKP36_RS04940 (VKP36_04940) | - | 992772..993854 (-) | 1083 | WP_326624261.1 | major capsid protein | - |
| VKP36_RS04945 (VKP36_04945) | - | 993857..994237 (-) | 381 | WP_111688464.1 | head decoration protein | - |
| VKP36_RS04950 (VKP36_04950) | - | 994247..994780 (-) | 534 | WP_010922217.1 | DUF4355 domain-containing protein | - |
| VKP36_RS04955 (VKP36_04955) | - | 994891..995058 (-) | 168 | WP_012679978.1 | hypothetical protein | - |
| VKP36_RS04960 (VKP36_04960) | - | 995094..995321 (-) | 228 | WP_326624264.1 | hypothetical protein | - |
| VKP36_RS04965 (VKP36_04965) | - | 995381..995560 (-) | 180 | WP_010922213.1 | hypothetical protein | - |
| VKP36_RS04970 (VKP36_04970) | - | 995551..997176 (-) | 1626 | WP_326624266.1 | minor capsid protein | - |
| VKP36_RS04975 (VKP36_04975) | - | 997157..998659 (-) | 1503 | WP_326624267.1 | phage portal protein | - |
| VKP36_RS04980 (VKP36_04980) | - | 998671..999978 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| VKP36_RS04985 (VKP36_04985) | - | 999956..1000387 (-) | 432 | WP_020833531.1 | terminase small subunit | - |
| VKP36_RS04990 (VKP36_04990) | - | 1000486..1000671 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| VKP36_RS04995 (VKP36_04995) | - | 1000723..1001100 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| VKP36_RS05000 (VKP36_05000) | - | 1001395..1001628 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| VKP36_RS05005 (VKP36_05005) | - | 1001718..1002632 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| VKP36_RS05010 (VKP36_05010) | - | 1003210..1003644 (-) | 435 | WP_326624270.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VKP36_RS05015 (VKP36_05015) | - | 1003918..1004553 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| VKP36_RS05020 (VKP36_05020) | - | 1004555..1004839 (-) | 285 | WP_136266292.1 | hypothetical protein | - |
| VKP36_RS05025 (VKP36_05025) | - | 1004836..1005216 (-) | 381 | WP_020833536.1 | YopX family protein | - |
| VKP36_RS05030 (VKP36_05030) | - | 1005226..1005495 (-) | 270 | WP_136266291.1 | hypothetical protein | - |
| VKP36_RS05035 (VKP36_05035) | - | 1005492..1005767 (-) | 276 | WP_136266290.1 | nucleotide modification associated domain-containing protein | - |
| VKP36_RS05040 (VKP36_05040) | - | 1005764..1005995 (-) | 232 | Protein_951 | hypothetical protein | - |
| VKP36_RS05045 (VKP36_05045) | - | 1005992..1006348 (-) | 357 | WP_136266289.1 | hypothetical protein | - |
| VKP36_RS05050 (VKP36_05050) | - | 1006332..1006616 (-) | 285 | WP_227874854.1 | VRR-NUC domain-containing protein | - |
| VKP36_RS05055 (VKP36_05055) | - | 1006636..1007505 (-) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| VKP36_RS05060 (VKP36_05060) | - | 1007774..1009327 (-) | 1554 | WP_326624277.1 | phage resistance protein | - |
| VKP36_RS05065 (VKP36_05065) | - | 1009345..1009827 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| VKP36_RS05070 (VKP36_05070) | - | 1009832..1011265 (-) | 1434 | Protein_957 | DEAD/DEAH box helicase | - |
| VKP36_RS05075 (VKP36_05075) | - | 1011271..1011954 (-) | 684 | WP_014635524.1 | AAA family ATPase | - |
| VKP36_RS05080 (VKP36_05080) | - | 1011951..1012235 (-) | 285 | WP_326624279.1 | hypothetical protein | - |
| VKP36_RS05085 (VKP36_05085) | - | 1012232..1012426 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| VKP36_RS05090 (VKP36_05090) | - | 1012426..1012755 (-) | 330 | WP_002984312.1 | hypothetical protein | - |
| VKP36_RS05095 (VKP36_05095) | - | 1012836..1012973 (-) | 138 | WP_002984309.1 | hypothetical protein | - |
| VKP36_RS05100 (VKP36_05100) | - | 1012970..1013266 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| VKP36_RS05105 (VKP36_05105) | - | 1013344..1013520 (-) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| VKP36_RS05110 (VKP36_05110) | - | 1013662..1013880 (+) | 219 | WP_023079659.1 | hypothetical protein | - |
| VKP36_RS05115 (VKP36_05115) | - | 1014056..1014265 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| VKP36_RS05120 (VKP36_05120) | - | 1014524..1015033 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| VKP36_RS05125 (VKP36_05125) | - | 1015164..1015373 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| VKP36_RS05130 (VKP36_05130) | - | 1015483..1015683 (-) | 201 | WP_326624284.1 | helix-turn-helix transcriptional regulator | - |
| VKP36_RS05135 (VKP36_05135) | - | 1015757..1016143 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| VKP36_RS05140 (VKP36_05140) | - | 1016132..1016341 (-) | 210 | WP_136288378.1 | hypothetical protein | - |
| VKP36_RS05145 (VKP36_05145) | - | 1016394..1016993 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| VKP36_RS05150 (VKP36_05150) | - | 1017023..1017181 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| VKP36_RS05155 (VKP36_05155) | - | 1017538..1018362 (+) | 825 | WP_326624289.1 | helix-turn-helix transcriptional regulator | - |
| VKP36_RS05160 (VKP36_05160) | - | 1018547..1019500 (+) | 954 | WP_136059184.1 | Abi family protein | - |
| VKP36_RS05165 (VKP36_05165) | - | 1019621..1020709 (+) | 1089 | WP_326624293.1 | tyrosine-type recombinase/integrase | - |
| VKP36_RS05170 (VKP36_05170) | - | 1021071..1021691 (+) | 621 | WP_326624295.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=925382 VKP36_RS04830 WP_011054546.1 973535..973723(-) (prx) [Streptococcus pyogenes strain AW-534]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=925382 VKP36_RS04830 WP_011054546.1 973535..973723(-) (prx) [Streptococcus pyogenes strain AW-534]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |