Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP54_RS05360 | Genome accession | NZ_CP142356 |
| Coordinates | 1079021..1079203 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain CT95-157 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1079021..1122048 | 1079021..1079203 | within | 0 |
Gene organization within MGE regions
Location: 1079021..1122048
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP54_RS05360 (VKP54_05360) | prx | 1079021..1079203 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| VKP54_RS05365 (VKP54_05365) | mf2 | 1079443..1080201 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| VKP54_RS05370 (VKP54_05370) | speC | 1080312..1081019 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VKP54_RS05375 (VKP54_05375) | - | 1081088..1081840 (-) | 753 | WP_023611694.1 | CHAP domain-containing protein | - |
| VKP54_RS05380 (VKP54_05380) | - | 1081842..1082174 (-) | 333 | WP_003052353.1 | phage holin | - |
| VKP54_RS05385 (VKP54_05385) | - | 1082176..1082505 (-) | 330 | WP_111694880.1 | hypothetical protein | - |
| VKP54_RS05390 (VKP54_05390) | - | 1082516..1083127 (-) | 612 | WP_111694881.1 | DUF1366 domain-containing protein | - |
| VKP54_RS05395 (VKP54_05395) | - | 1083130..1083558 (-) | 429 | WP_111694882.1 | DUF1617 family protein | - |
| VKP54_RS05400 (VKP54_05400) | - | 1083567..1085390 (-) | 1824 | WP_111711359.1 | gp58-like family protein | - |
| VKP54_RS05405 (VKP54_05405) | - | 1085401..1085715 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| VKP54_RS05410 (VKP54_05410) | - | 1085717..1086940 (-) | 1224 | WP_030127718.1 | hypothetical protein | - |
| VKP54_RS05415 (VKP54_05415) | - | 1086937..1089084 (-) | 2148 | WP_111694884.1 | phage tail spike protein | - |
| VKP54_RS05420 (VKP54_05420) | - | 1089081..1089797 (-) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| VKP54_RS05425 (VKP54_05425) | - | 1089794..1093054 (-) | 3261 | WP_129820702.1 | tape measure protein | - |
| VKP54_RS05430 (VKP54_05430) | - | 1093044..1093625 (-) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| VKP54_RS05435 (VKP54_05435) | - | 1093629..1094063 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| VKP54_RS05440 (VKP54_05440) | - | 1094116..1094586 (-) | 471 | WP_011527917.1 | phage tail tube protein | - |
| VKP54_RS05445 (VKP54_05445) | - | 1094586..1094984 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| VKP54_RS05450 (VKP54_05450) | - | 1094981..1095337 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| VKP54_RS05455 (VKP54_05455) | - | 1095337..1095669 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| VKP54_RS05460 (VKP54_05460) | - | 1095659..1096075 (-) | 417 | WP_111694886.1 | hypothetical protein | - |
| VKP54_RS05465 (VKP54_05465) | - | 1096129..1096947 (-) | 819 | WP_111711357.1 | N4-gp56 family major capsid protein | - |
| VKP54_RS05470 (VKP54_05470) | - | 1096951..1097565 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| VKP54_RS05475 (VKP54_05475) | - | 1097691..1097957 (-) | 267 | WP_111694887.1 | hypothetical protein | - |
| VKP54_RS05480 (VKP54_05480) | - | 1098019..1098258 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| VKP54_RS05485 (VKP54_05485) | - | 1098230..1099708 (-) | 1479 | WP_326612731.1 | phage minor capsid protein | - |
| VKP54_RS05490 (VKP54_05490) | - | 1099713..1101215 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| VKP54_RS05495 (VKP54_05495) | - | 1101229..1102524 (-) | 1296 | WP_165363098.1 | PBSX family phage terminase large subunit | - |
| VKP54_RS05500 (VKP54_05500) | terS | 1102517..1103212 (-) | 696 | WP_050318691.1 | phage terminase small subunit | - |
| VKP54_RS05505 (VKP54_05505) | - | 1103332..1103748 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| VKP54_RS05510 (VKP54_05510) | - | 1103881..1104153 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| VKP54_RS05515 (VKP54_05515) | - | 1104146..1104316 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| VKP54_RS05520 (VKP54_05520) | - | 1104317..1105639 (-) | 1323 | WP_111694889.1 | SNF2-related protein | - |
| VKP54_RS05525 (VKP54_05525) | - | 1105636..1105911 (-) | 276 | WP_129820701.1 | VRR-NUC domain-containing protein | - |
| VKP54_RS05530 (VKP54_05530) | - | 1106297..1108681 (-) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| VKP54_RS05535 (VKP54_05535) | - | 1108686..1110608 (-) | 1923 | WP_111674645.1 | DNA polymerase | - |
| VKP54_RS05540 (VKP54_05540) | - | 1110651..1111214 (-) | 564 | WP_111674646.1 | DUF2815 family protein | - |
| VKP54_RS05545 (VKP54_05545) | - | 1111223..1112380 (-) | 1158 | WP_023611034.1 | DUF2800 domain-containing protein | - |
| VKP54_RS05550 (VKP54_05550) | - | 1112380..1112679 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| VKP54_RS05555 (VKP54_05555) | - | 1112768..1112971 (-) | 204 | WP_023611025.1 | hypothetical protein | - |
| VKP54_RS05560 (VKP54_05560) | - | 1113461..1113847 (-) | 387 | WP_111694890.1 | hypothetical protein | - |
| VKP54_RS05565 (VKP54_05565) | - | 1113844..1114060 (-) | 217 | Protein_1058 | hypothetical protein | - |
| VKP54_RS05570 (VKP54_05570) | - | 1114053..1114223 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| VKP54_RS05575 (VKP54_05575) | - | 1114225..1114536 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| VKP54_RS05580 (VKP54_05580) | - | 1114643..1114858 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| VKP54_RS05585 (VKP54_05585) | - | 1114832..1115080 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| VKP54_RS05590 (VKP54_05590) | - | 1115160..1115369 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| VKP54_RS05595 (VKP54_05595) | - | 1115511..1115771 (+) | 261 | WP_023611024.1 | hypothetical protein | - |
| VKP54_RS05600 (VKP54_05600) | - | 1115870..1116523 (-) | 654 | WP_111688314.1 | phage antirepressor KilAC domain-containing protein | - |
| VKP54_RS05605 (VKP54_05605) | - | 1116535..1116726 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| VKP54_RS05610 (VKP54_05610) | - | 1117362..1117457 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| VKP54_RS05615 (VKP54_05615) | - | 1117879..1118226 (+) | 348 | WP_111688316.1 | helix-turn-helix domain-containing protein | - |
| VKP54_RS05620 (VKP54_05620) | - | 1118230..1118610 (+) | 381 | WP_111711356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VKP54_RS05625 (VKP54_05625) | - | 1118622..1118888 (+) | 267 | WP_076634078.1 | DUF4177 domain-containing protein | - |
| VKP54_RS05630 (VKP54_05630) | - | 1119017..1120159 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| VKP54_RS05635 (VKP54_05635) | - | 1120249..1120524 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP54_RS05640 (VKP54_05640) | - | 1120623..1121210 (-) | 588 | WP_111711355.1 | YpmS family protein | - |
| VKP54_RS05645 (VKP54_05645) | - | 1121188..1122030 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=925331 VKP54_RS05360 WP_011184726.1 1079021..1079203(-) (prx) [Streptococcus pyogenes strain CT95-157]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925331 VKP54_RS05360 WP_011184726.1 1079021..1079203(-) (prx) [Streptococcus pyogenes strain CT95-157]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |