Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP40_RS03435 | Genome accession | NZ_CP142355 |
| Coordinates | 659887..660069 (+) | Length | 60 a.a. |
| NCBI ID | WP_053308468.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain A946 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623409..660069 | 659887..660069 | within | 0 |
Gene organization within MGE regions
Location: 623409..660069
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP40_RS03155 (VKP40_03155) | - | 623427..624269 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| VKP40_RS03160 (VKP40_03160) | - | 624247..624834 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| VKP40_RS03165 (VKP40_03165) | - | 624933..625208 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP40_RS03170 (VKP40_03170) | - | 625298..626440 (-) | 1143 | WP_115223139.1 | tyrosine-type recombinase/integrase | - |
| VKP40_RS03175 (VKP40_03175) | - | 626564..627082 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| VKP40_RS03180 (VKP40_03180) | - | 627094..627849 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP40_RS03185 (VKP40_03185) | - | 628050..628262 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP40_RS03190 (VKP40_03190) | - | 628532..628843 (+) | 312 | WP_326676066.1 | excisionase | - |
| VKP40_RS03195 (VKP40_03195) | - | 628845..629030 (+) | 186 | WP_023079923.1 | hypothetical protein | - |
| VKP40_RS03200 (VKP40_03200) | - | 629124..629393 (+) | 270 | WP_053308490.1 | replication protein | - |
| VKP40_RS03205 (VKP40_03205) | - | 629534..629920 (+) | 387 | WP_023079927.1 | DnaD domain-containing protein | - |
| VKP40_RS03210 (VKP40_03210) | - | 629901..630134 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| VKP40_RS03215 (VKP40_03215) | - | 630131..630271 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| VKP40_RS03220 (VKP40_03220) | - | 630280..630486 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| VKP40_RS03225 (VKP40_03225) | - | 630542..630871 (+) | 330 | WP_032463369.1 | hypothetical protein | - |
| VKP40_RS03230 (VKP40_03230) | - | 630874..631803 (+) | 930 | WP_326676069.1 | recombinase RecT | - |
| VKP40_RS03235 (VKP40_03235) | - | 631800..632597 (+) | 798 | WP_053308488.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VKP40_RS03240 (VKP40_03240) | - | 632951..633292 (+) | 342 | WP_053308487.1 | hypothetical protein | - |
| VKP40_RS03245 (VKP40_03245) | - | 633289..633801 (+) | 513 | WP_053308486.1 | hypothetical protein | - |
| VKP40_RS03250 (VKP40_03250) | - | 633788..633973 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| VKP40_RS03255 (VKP40_03255) | - | 634040..634258 (+) | 219 | Protein_579 | DUF1642 domain-containing protein | - |
| VKP40_RS03260 (VKP40_03260) | - | 634255..634506 (+) | 252 | WP_011017981.1 | hypothetical protein | - |
| VKP40_RS03265 (VKP40_03265) | - | 634582..635001 (+) | 420 | WP_003047501.1 | DUF1492 domain-containing protein | - |
| VKP40_RS03270 (VKP40_03270) | - | 635109..635453 (+) | 345 | WP_053308484.1 | HNH endonuclease signature motif containing protein | - |
| VKP40_RS03275 (VKP40_03275) | - | 635603..635959 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| VKP40_RS03280 (VKP40_03280) | - | 635956..637224 (+) | 1269 | Protein_584 | hypothetical protein | - |
| VKP40_RS03285 (VKP40_03285) | - | 637217..638710 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| VKP40_RS03290 (VKP40_03290) | - | 638716..638940 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| VKP40_RS03295 (VKP40_03295) | - | 638990..639169 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| VKP40_RS03300 (VKP40_03300) | - | 639162..639428 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| VKP40_RS03305 (VKP40_03305) | - | 639430..639666 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| VKP40_RS03310 (VKP40_03310) | - | 639748..641163 (+) | 1416 | WP_011285619.1 | terminase | - |
| VKP40_RS03315 (VKP40_03315) | - | 641244..641708 (+) | 465 | WP_053308482.1 | DUF4355 domain-containing protein | - |
| VKP40_RS03320 (VKP40_03320) | - | 641712..642605 (+) | 894 | WP_053308481.1 | phage major capsid protein | - |
| VKP40_RS03325 (VKP40_03325) | - | 642607..642735 (+) | 129 | WP_258296905.1 | hypothetical protein | - |
| VKP40_RS03330 (VKP40_03330) | - | 642756..643178 (+) | 423 | WP_053308480.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP40_RS03335 (VKP40_03335) | - | 643138..643476 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| VKP40_RS03340 (VKP40_03340) | - | 643469..643705 (+) | 237 | WP_053308479.1 | hypothetical protein | - |
| VKP40_RS03345 (VKP40_03345) | - | 643706..644041 (+) | 336 | WP_326676073.1 | hypothetical protein | - |
| VKP40_RS03350 (VKP40_03350) | - | 644057..644647 (+) | 591 | WP_053308478.1 | hypothetical protein | - |
| VKP40_RS03355 (VKP40_03355) | - | 644658..644921 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| VKP40_RS03360 (VKP40_03360) | - | 644936..645307 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| VKP40_RS03365 (VKP40_03365) | - | 645307..647664 (+) | 2358 | WP_053308477.1 | hypothetical protein | - |
| VKP40_RS03370 (VKP40_03370) | - | 647661..648356 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| VKP40_RS03375 (VKP40_03375) | - | 648353..650311 (+) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| VKP40_RS03380 (VKP40_03380) | - | 650311..651420 (+) | 1110 | WP_053308475.1 | hyaluronoglucosaminidase | - |
| VKP40_RS03385 (VKP40_03385) | - | 651435..653216 (+) | 1782 | WP_136110606.1 | gp58-like family protein | - |
| VKP40_RS03390 (VKP40_03390) | - | 653225..653656 (+) | 432 | WP_053308473.1 | DUF1617 family protein | - |
| VKP40_RS03395 (VKP40_03395) | - | 653659..654300 (+) | 642 | WP_053308472.1 | hypothetical protein | - |
| VKP40_RS03400 (VKP40_03400) | - | 654297..654593 (+) | 297 | WP_053308471.1 | hypothetical protein | - |
| VKP40_RS03405 (VKP40_03405) | - | 654590..654775 (+) | 186 | WP_011184796.1 | holin | - |
| VKP40_RS03410 (VKP40_03410) | - | 654886..655440 (+) | 555 | Protein_610 | glycoside hydrolase family 73 protein | - |
| VKP40_RS03415 (VKP40_03415) | - | 655676..656368 (+) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| VKP40_RS03420 (VKP40_03420) | - | 656481..657122 (+) | 642 | Protein_612 | CHAP domain-containing protein | - |
| VKP40_RS03425 (VKP40_03425) | spem | 657989..658702 (+) | 714 | WP_326676076.1 | streptococcal pyrogenic exotoxin SpeM | - |
| VKP40_RS03430 (VKP40_03430) | spel | 658984..659772 (+) | 789 | WP_326676078.1 | streptococcal pyrogenic exotoxin SpeL | - |
| VKP40_RS03435 (VKP40_03435) | prx | 659887..660069 (+) | 183 | WP_053308468.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7066.02 Da Isoelectric Point: 4.0338
>NTDB_id=925271 VKP40_RS03435 WP_053308468.1 659887..660069(+) (prx) [Streptococcus pyogenes strain A946]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925271 VKP40_RS03435 WP_053308468.1 659887..660069(+) (prx) [Streptococcus pyogenes strain A946]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
88.333 |
100 |
0.883 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
70 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |