Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP53_RS03570 | Genome accession | NZ_CP142354 |
| Coordinates | 682083..682265 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain 6745-99 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 646184..682265 | 682083..682265 | within | 0 |
Gene organization within MGE regions
Location: 646184..682265
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP53_RS03290 (VKP53_03290) | - | 646202..647044 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| VKP53_RS03295 (VKP53_03295) | - | 647022..647609 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| VKP53_RS03300 (VKP53_03300) | - | 647708..647983 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP53_RS03305 (VKP53_03305) | - | 648073..649215 (-) | 1143 | WP_115223139.1 | tyrosine-type recombinase/integrase | - |
| VKP53_RS03310 (VKP53_03310) | - | 649340..649858 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| VKP53_RS03315 (VKP53_03315) | - | 649870..650625 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP53_RS03320 (VKP53_03320) | - | 650827..651039 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP53_RS03325 (VKP53_03325) | - | 651309..651620 (+) | 312 | WP_010922478.1 | excisionase | - |
| VKP53_RS03330 (VKP53_03330) | - | 651622..651807 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| VKP53_RS03335 (VKP53_03335) | - | 651901..652170 (+) | 270 | WP_011106700.1 | replication protein | - |
| VKP53_RS03340 (VKP53_03340) | - | 652311..652697 (+) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| VKP53_RS03345 (VKP53_03345) | - | 652678..652911 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| VKP53_RS03350 (VKP53_03350) | - | 652908..653048 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| VKP53_RS03355 (VKP53_03355) | - | 653057..653263 (+) | 207 | WP_002990074.1 | hypothetical protein | - |
| VKP53_RS03360 (VKP53_03360) | - | 653319..653648 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| VKP53_RS03365 (VKP53_03365) | - | 653651..654622 (+) | 972 | WP_136273419.1 | recombinase RecT | - |
| VKP53_RS03370 (VKP53_03370) | - | 654619..654819 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| VKP53_RS03375 (VKP53_03375) | - | 654812..655609 (+) | 798 | WP_002988362.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VKP53_RS03380 (VKP53_03380) | - | 655786..656127 (+) | 342 | WP_002985383.1 | hypothetical protein | - |
| VKP53_RS03385 (VKP53_03385) | - | 656124..656636 (+) | 513 | WP_063631459.1 | hypothetical protein | - |
| VKP53_RS03390 (VKP53_03390) | - | 656623..656808 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| VKP53_RS03395 (VKP53_03395) | - | 656813..657082 (+) | 270 | WP_063662147.1 | hypothetical protein | - |
| VKP53_RS03400 (VKP53_03400) | - | 657084..657719 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| VKP53_RS03405 (VKP53_03405) | - | 657986..658405 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| VKP53_RS03410 (VKP53_03410) | - | 658512..658856 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| VKP53_RS03415 (VKP53_03415) | - | 659006..659362 (+) | 357 | WP_109828582.1 | hypothetical protein | - |
| VKP53_RS03420 (VKP53_03420) | - | 659359..660627 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| VKP53_RS03425 (VKP53_03425) | - | 660620..662113 (+) | 1494 | WP_326675087.1 | hypothetical protein | - |
| VKP53_RS03430 (VKP53_03430) | - | 662119..662343 (+) | 225 | WP_326673894.1 | hypothetical protein | - |
| VKP53_RS03435 (VKP53_03435) | - | 662393..662572 (+) | 180 | WP_002994098.1 | hypothetical protein | - |
| VKP53_RS03440 (VKP53_03440) | - | 662565..662834 (+) | 270 | WP_002994096.1 | hypothetical protein | - |
| VKP53_RS03445 (VKP53_03445) | - | 662898..664313 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| VKP53_RS03450 (VKP53_03450) | - | 664394..664855 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| VKP53_RS03455 (VKP53_03455) | - | 664880..665791 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| VKP53_RS03460 (VKP53_03460) | - | 665791..665991 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| VKP53_RS03465 (VKP53_03465) | - | 666001..666420 (+) | 420 | WP_063662149.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP53_RS03470 (VKP53_03470) | - | 666383..666721 (+) | 339 | WP_063662151.1 | hypothetical protein | - |
| VKP53_RS03475 (VKP53_03475) | - | 666714..666950 (+) | 237 | WP_053308479.1 | hypothetical protein | - |
| VKP53_RS03480 (VKP53_03480) | - | 666951..667286 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| VKP53_RS03485 (VKP53_03485) | - | 667298..667882 (+) | 585 | WP_063632574.1 | hypothetical protein | - |
| VKP53_RS03490 (VKP53_03490) | - | 667892..668155 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| VKP53_RS03495 (VKP53_03495) | - | 668170..668541 (+) | 372 | WP_326675093.1 | DUF5361 domain-containing protein | - |
| VKP53_RS03500 (VKP53_03500) | - | 668541..669068 (+) | 528 | Protein_630 | hypothetical protein | - |
| VKP53_RS03505 (VKP53_03505) | - | 669241..669801 (+) | 561 | WP_011017973.1 | HNH endonuclease | - |
| VKP53_RS03510 (VKP53_03510) | - | 670009..671817 (+) | 1809 | WP_326675095.1 | hypothetical protein | - |
| VKP53_RS03515 (VKP53_03515) | - | 671814..672509 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| VKP53_RS03520 (VKP53_03520) | - | 672506..674470 (+) | 1965 | WP_326675097.1 | phage tail spike protein | - |
| VKP53_RS03525 (VKP53_03525) | hylP | 674470..675492 (+) | 1023 | WP_168390558.1 | hyaluronidase HylP | - |
| VKP53_RS03530 (VKP53_03530) | - | 675507..677291 (+) | 1785 | WP_002993792.1 | gp58-like family protein | - |
| VKP53_RS03535 (VKP53_03535) | - | 677303..677734 (+) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| VKP53_RS03540 (VKP53_03540) | - | 677737..678354 (+) | 618 | WP_063662167.1 | DUF1366 domain-containing protein | - |
| VKP53_RS03545 (VKP53_03545) | - | 678366..678638 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| VKP53_RS03550 (VKP53_03550) | - | 678635..678862 (+) | 228 | WP_003058873.1 | phage holin | - |
| VKP53_RS03555 (VKP53_03555) | - | 678981..680198 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| VKP53_RS03560 (VKP53_03560) | speC | 680267..680974 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VKP53_RS03565 (VKP53_03565) | mf2 | 681085..681843 (-) | 759 | WP_014635573.1 | DNase Mf2 | - |
| VKP53_RS03570 (VKP53_03570) | prx | 682083..682265 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=925216 VKP53_RS03570 WP_014635572.1 682083..682265(+) (prx) [Streptococcus pyogenes strain 6745-99]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925216 VKP53_RS03570 WP_014635572.1 682083..682265(+) (prx) [Streptococcus pyogenes strain 6745-99]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |