Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP38_RS03715 | Genome accession | NZ_CP142352 |
| Coordinates | 700280..700462 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain 2907-97 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 665823..700462 | 700280..700462 | within | 0 |
Gene organization within MGE regions
Location: 665823..700462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP38_RS03440 (VKP38_03440) | - | 665823..666098 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP38_RS03445 (VKP38_03445) | - | 666187..667329 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| VKP38_RS03450 (VKP38_03450) | - | 667453..667971 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| VKP38_RS03455 (VKP38_03455) | - | 667983..668738 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP38_RS03460 (VKP38_03460) | - | 668940..669152 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP38_RS03465 (VKP38_03465) | - | 669321..669503 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| VKP38_RS03470 (VKP38_03470) | - | 669609..669920 (+) | 312 | WP_063632990.1 | hypothetical protein | - |
| VKP38_RS03475 (VKP38_03475) | - | 669996..670355 (+) | 360 | WP_012560976.1 | hypothetical protein | - |
| VKP38_RS03480 (VKP38_03480) | - | 670468..670635 (+) | 168 | Protein_626 | excisionase | - |
| VKP38_RS03485 (VKP38_03485) | - | 670637..670822 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| VKP38_RS03490 (VKP38_03490) | - | 670916..671185 (+) | 270 | WP_011106700.1 | replication protein | - |
| VKP38_RS03495 (VKP38_03495) | - | 671326..671712 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| VKP38_RS03500 (VKP38_03500) | - | 671693..671926 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| VKP38_RS03505 (VKP38_03505) | - | 671923..672063 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| VKP38_RS03510 (VKP38_03510) | - | 672072..672278 (+) | 207 | WP_002990074.1 | hypothetical protein | - |
| VKP38_RS03515 (VKP38_03515) | - | 672334..672663 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| VKP38_RS03520 (VKP38_03520) | bet | 672666..673457 (+) | 792 | WP_136308196.1 | phage recombination protein Bet | - |
| VKP38_RS03525 (VKP38_03525) | - | 673467..674495 (+) | 1029 | WP_002993808.1 | DUF1351 domain-containing protein | - |
| VKP38_RS03530 (VKP38_03530) | - | 674671..674904 (+) | 234 | Protein_636 | hypothetical protein | - |
| VKP38_RS03535 (VKP38_03535) | - | 674901..675413 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| VKP38_RS03540 (VKP38_03540) | - | 675400..675603 (+) | 204 | WP_063629031.1 | hypothetical protein | - |
| VKP38_RS03545 (VKP38_03545) | - | 675590..675874 (+) | 285 | WP_063629032.1 | hypothetical protein | - |
| VKP38_RS03550 (VKP38_03550) | - | 675876..676511 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| VKP38_RS03555 (VKP38_03555) | - | 676778..677197 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| VKP38_RS03560 (VKP38_03560) | - | 677304..677675 (+) | 372 | WP_136308197.1 | HNH endonuclease signature motif containing protein | - |
| VKP38_RS03565 (VKP38_03565) | - | 677786..678142 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| VKP38_RS03570 (VKP38_03570) | - | 678139..679407 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| VKP38_RS03575 (VKP38_03575) | - | 679400..680893 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| VKP38_RS03580 (VKP38_03580) | - | 680899..681123 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| VKP38_RS03585 (VKP38_03585) | - | 681173..681352 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| VKP38_RS03590 (VKP38_03590) | - | 681345..681611 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| VKP38_RS03595 (VKP38_03595) | - | 681613..681849 (+) | 237 | Protein_649 | hypothetical protein | - |
| VKP38_RS03600 (VKP38_03600) | - | 681931..683346 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| VKP38_RS03605 (VKP38_03605) | - | 683426..683887 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| VKP38_RS03610 (VKP38_03610) | - | 683912..684823 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| VKP38_RS03615 (VKP38_03615) | - | 684823..685023 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| VKP38_RS03620 (VKP38_03620) | - | 685033..685455 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP38_RS03625 (VKP38_03625) | - | 685415..685753 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| VKP38_RS03630 (VKP38_03630) | - | 685746..685982 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| VKP38_RS03635 (VKP38_03635) | - | 685983..686318 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| VKP38_RS03640 (VKP38_03640) | - | 686334..686924 (+) | 591 | WP_053308478.1 | hypothetical protein | - |
| VKP38_RS03645 (VKP38_03645) | - | 686935..687198 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| VKP38_RS03650 (VKP38_03650) | - | 687213..687584 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| VKP38_RS03655 (VKP38_03655) | - | 687584..689941 (+) | 2358 | WP_053308477.1 | hypothetical protein | - |
| VKP38_RS03660 (VKP38_03660) | - | 689938..690633 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| VKP38_RS03665 (VKP38_03665) | - | 690630..692588 (+) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| VKP38_RS03670 (VKP38_03670) | - | 692588..693697 (+) | 1110 | WP_136094931.1 | hyaluronoglucosaminidase | - |
| VKP38_RS03675 (VKP38_03675) | - | 693712..695493 (+) | 1782 | WP_136110606.1 | gp58-like family protein | - |
| VKP38_RS03680 (VKP38_03680) | - | 695502..695933 (+) | 432 | WP_136107654.1 | DUF1617 family protein | - |
| VKP38_RS03685 (VKP38_03685) | - | 695936..696553 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| VKP38_RS03690 (VKP38_03690) | - | 696563..696835 (+) | 273 | WP_019418840.1 | hypothetical protein | - |
| VKP38_RS03695 (VKP38_03695) | - | 696832..697059 (+) | 228 | WP_063632963.1 | phage holin | - |
| VKP38_RS03700 (VKP38_03700) | - | 697178..698395 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| VKP38_RS03705 (VKP38_03705) | speC | 698464..699171 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VKP38_RS03710 (VKP38_03710) | mf2 | 699282..700040 (-) | 759 | WP_014635573.1 | DNase Mf2 | - |
| VKP38_RS03715 (VKP38_03715) | prx | 700280..700462 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=925104 VKP38_RS03715 WP_014635572.1 700280..700462(+) (prx) [Streptococcus pyogenes strain 2907-97]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925104 VKP38_RS03715 WP_014635572.1 700280..700462(+) (prx) [Streptococcus pyogenes strain 2907-97]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |