Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP55_RS05450 | Genome accession | NZ_CP142351 |
| Coordinates | 1099024..1099206 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SS1366 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1099024..1134348 | 1099024..1099206 | within | 0 |
Gene organization within MGE regions
Location: 1099024..1134348
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP55_RS05450 (VKP55_05450) | prx | 1099024..1099206 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| VKP55_RS05455 (VKP55_05455) | mf2 | 1099446..1100204 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| VKP55_RS05460 (VKP55_05460) | speC | 1100315..1101022 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| VKP55_RS05465 (VKP55_05465) | - | 1101091..1102308 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| VKP55_RS05470 (VKP55_05470) | - | 1102427..1102654 (-) | 228 | WP_003058873.1 | phage holin | - |
| VKP55_RS05475 (VKP55_05475) | - | 1102651..1102923 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| VKP55_RS05480 (VKP55_05480) | - | 1102935..1103567 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| VKP55_RS05485 (VKP55_05485) | - | 1103570..1103998 (-) | 429 | WP_136266864.1 | DUF1617 family protein | - |
| VKP55_RS05490 (VKP55_05490) | - | 1104007..1105788 (-) | 1782 | WP_063662161.1 | gp58-like family protein | - |
| VKP55_RS05495 (VKP55_05495) | - | 1105803..1106918 (-) | 1116 | WP_063662158.1 | hyaluronoglucosaminidase | - |
| VKP55_RS05500 (VKP55_05500) | - | 1106918..1108891 (-) | 1974 | WP_168434316.1 | phage tail spike protein | - |
| VKP55_RS05505 (VKP55_05505) | - | 1108873..1109568 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| VKP55_RS05510 (VKP55_05510) | - | 1109565..1111373 (-) | 1809 | WP_326673887.1 | hypothetical protein | - |
| VKP55_RS05515 (VKP55_05515) | - | 1111581..1112141 (-) | 561 | WP_011017973.1 | HNH endonuclease | - |
| VKP55_RS05520 (VKP55_05520) | - | 1112314..1112841 (-) | 528 | Protein_1047 | hypothetical protein | - |
| VKP55_RS05525 (VKP55_05525) | - | 1112841..1113212 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| VKP55_RS05530 (VKP55_05530) | - | 1113227..1113490 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| VKP55_RS05535 (VKP55_05535) | - | 1113501..1114091 (-) | 591 | WP_021733477.1 | hypothetical protein | - |
| VKP55_RS05540 (VKP55_05540) | - | 1114107..1114442 (-) | 336 | WP_021733481.1 | hypothetical protein | - |
| VKP55_RS05545 (VKP55_05545) | - | 1114443..1114679 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| VKP55_RS05550 (VKP55_05550) | - | 1114672..1115010 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| VKP55_RS05555 (VKP55_05555) | - | 1114970..1115392 (-) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP55_RS05560 (VKP55_05560) | - | 1115402..1115602 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| VKP55_RS05565 (VKP55_05565) | - | 1115602..1116513 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| VKP55_RS05570 (VKP55_05570) | - | 1116538..1116999 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| VKP55_RS05575 (VKP55_05575) | - | 1117081..1118496 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| VKP55_RS05580 (VKP55_05580) | - | 1118560..1118829 (-) | 270 | WP_002994096.1 | hypothetical protein | - |
| VKP55_RS05585 (VKP55_05585) | - | 1118822..1119001 (-) | 180 | WP_326674550.1 | hypothetical protein | - |
| VKP55_RS05590 (VKP55_05590) | - | 1119051..1119275 (-) | 225 | WP_326673894.1 | hypothetical protein | - |
| VKP55_RS05595 (VKP55_05595) | - | 1119281..1120774 (-) | 1494 | WP_326673896.1 | hypothetical protein | - |
| VKP55_RS05600 (VKP55_05600) | - | 1120767..1122035 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| VKP55_RS05605 (VKP55_05605) | - | 1122032..1122388 (-) | 357 | WP_109828582.1 | hypothetical protein | - |
| VKP55_RS05610 (VKP55_05610) | - | 1122537..1122881 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| VKP55_RS05615 (VKP55_05615) | - | 1122991..1123410 (-) | 420 | WP_021733384.1 | DUF1492 domain-containing protein | - |
| VKP55_RS05620 (VKP55_05620) | - | 1123676..1123846 (-) | 171 | WP_168389619.1 | hypothetical protein | - |
| VKP55_RS05625 (VKP55_05625) | - | 1123851..1124036 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| VKP55_RS05630 (VKP55_05630) | - | 1124023..1124535 (-) | 513 | WP_011888758.1 | hypothetical protein | - |
| VKP55_RS05635 (VKP55_05635) | - | 1124532..1124873 (-) | 342 | WP_011888757.1 | hypothetical protein | - |
| VKP55_RS05640 (VKP55_05640) | - | 1125069..1126097 (-) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| VKP55_RS05645 (VKP55_05645) | bet | 1126107..1126883 (-) | 777 | WP_011888755.1 | phage recombination protein Bet | - |
| VKP55_RS05650 (VKP55_05650) | - | 1126886..1127215 (-) | 330 | WP_011888754.1 | hypothetical protein | - |
| VKP55_RS05655 (VKP55_05655) | - | 1127271..1127477 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| VKP55_RS05660 (VKP55_05660) | - | 1127486..1127626 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| VKP55_RS05665 (VKP55_05665) | - | 1127623..1127856 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| VKP55_RS05670 (VKP55_05670) | - | 1127837..1128223 (-) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| VKP55_RS05675 (VKP55_05675) | - | 1128363..1128632 (-) | 270 | WP_038433488.1 | replication protein | - |
| VKP55_RS05680 (VKP55_05680) | - | 1128726..1128911 (-) | 186 | WP_326673905.1 | hypothetical protein | - |
| VKP55_RS05685 (VKP55_05685) | - | 1128913..1129224 (-) | 312 | WP_010922478.1 | excisionase | - |
| VKP55_RS05690 (VKP55_05690) | - | 1129494..1129706 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP55_RS05695 (VKP55_05695) | - | 1129908..1130663 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP55_RS05700 (VKP55_05700) | - | 1130675..1131193 (+) | 519 | WP_326673907.1 | HIRAN domain-containing protein | - |
| VKP55_RS05705 (VKP55_05705) | - | 1131317..1132459 (+) | 1143 | WP_115223139.1 | tyrosine-type recombinase/integrase | - |
| VKP55_RS05710 (VKP55_05710) | - | 1132549..1132824 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| VKP55_RS05715 (VKP55_05715) | - | 1132923..1133510 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| VKP55_RS05720 (VKP55_05720) | - | 1133488..1134330 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=925056 VKP55_RS05450 WP_011184726.1 1099024..1099206(-) (prx) [Streptococcus pyogenes strain SS1366]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925056 VKP55_RS05450 WP_011184726.1 1099024..1099206(-) (prx) [Streptococcus pyogenes strain SS1366]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |