Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP55_RS00500 | Genome accession | NZ_CP142351 |
| Coordinates | 74190..74372 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SS1366 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12775..86858 | 74190..74372 | within | 0 |
Gene organization within MGE regions
Location: 12775..86858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP55_RS00065 (VKP55_00065) | ftsH | 12775..14754 (+) | 1980 | WP_002981901.1 | ATP-dependent zinc metalloprotease FtsH | - |
| VKP55_RS00070 (VKP55_00070) | - | 15080..16471 (+) | 1392 | WP_014635212.1 | APC family permease | - |
| VKP55_RS08910 | - | 29774..29980 (-) | 207 | Protein_14 | hypothetical protein | - |
| VKP55_RS08915 | - | 30134..30415 (-) | 282 | WP_109821002.1 | transposase | - |
| VKP55_RS00245 (VKP55_00245) | pcsB | 31162..32358 (+) | 1197 | WP_020833179.1 | peptidoglycan hydrolase PcsB | - |
| VKP55_RS00250 (VKP55_00250) | - | 32611..33573 (+) | 963 | WP_002986722.1 | ribose-phosphate diphosphokinase | - |
| VKP55_RS00255 (VKP55_00255) | recO | 33759..34514 (+) | 756 | WP_111688210.1 | DNA repair protein RecO | - |
| VKP55_RS00260 (VKP55_00260) | - | 34646..35734 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| VKP55_RS00265 (VKP55_00265) | - | 35910..36461 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| VKP55_RS00270 (VKP55_00270) | - | 36472..36855 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VKP55_RS00275 (VKP55_00275) | - | 36869..37219 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| VKP55_RS00280 (VKP55_00280) | - | 37858..38049 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| VKP55_RS00285 (VKP55_00285) | - | 38100..38300 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| VKP55_RS00290 (VKP55_00290) | - | 38389..38646 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| VKP55_RS00295 (VKP55_00295) | - | 38675..38845 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| VKP55_RS00300 (VKP55_00300) | - | 38838..39045 (+) | 208 | Protein_27 | hypothetical protein | - |
| VKP55_RS00305 (VKP55_00305) | - | 39042..39425 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| VKP55_RS00310 (VKP55_00310) | - | 39570..39773 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| VKP55_RS00315 (VKP55_00315) | - | 39861..40160 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| VKP55_RS00320 (VKP55_00320) | - | 40160..41317 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| VKP55_RS00325 (VKP55_00325) | - | 41331..41894 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| VKP55_RS00330 (VKP55_00330) | - | 41937..43859 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| VKP55_RS00335 (VKP55_00335) | - | 43864..46248 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| VKP55_RS00340 (VKP55_00340) | - | 46613..46888 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| VKP55_RS00345 (VKP55_00345) | - | 46885..48207 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| VKP55_RS00350 (VKP55_00350) | - | 48208..48378 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| VKP55_RS00355 (VKP55_00355) | - | 48371..48643 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| VKP55_RS00360 (VKP55_00360) | - | 48776..49192 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| VKP55_RS00365 (VKP55_00365) | - | 49282..49734 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| VKP55_RS00370 (VKP55_00370) | - | 49724..51001 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| VKP55_RS00375 (VKP55_00375) | - | 51017..52549 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| VKP55_RS00380 (VKP55_00380) | - | 52509..53957 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| VKP55_RS00385 (VKP55_00385) | - | 53985..54173 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| VKP55_RS00390 (VKP55_00390) | - | 54178..54444 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| VKP55_RS00395 (VKP55_00395) | - | 54612..55181 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| VKP55_RS00400 (VKP55_00400) | - | 55194..56081 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| VKP55_RS00405 (VKP55_00405) | - | 56093..56449 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| VKP55_RS00410 (VKP55_00410) | - | 56460..56738 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| VKP55_RS00415 (VKP55_00415) | - | 56735..57079 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VKP55_RS00420 (VKP55_00420) | - | 57083..57442 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| VKP55_RS00425 (VKP55_00425) | - | 57454..58053 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| VKP55_RS00430 (VKP55_00430) | - | 58107..58562 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| VKP55_RS00435 (VKP55_00435) | - | 58637..58870 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| VKP55_RS00440 (VKP55_00440) | - | 58885..63267 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| VKP55_RS00445 (VKP55_00445) | - | 63279..64121 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| VKP55_RS00450 (VKP55_00450) | - | 64131..66110 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| VKP55_RS00455 (VKP55_00455) | - | 66107..67114 (+) | 1008 | WP_326674251.1 | hyaluronoglucosaminidase | - |
| VKP55_RS00460 (VKP55_00460) | - | 67127..69142 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| VKP55_RS00465 (VKP55_00465) | - | 69154..69591 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| VKP55_RS00470 (VKP55_00470) | - | 69588..70205 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| VKP55_RS00475 (VKP55_00475) | - | 70215..70487 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| VKP55_RS00480 (VKP55_00480) | - | 70484..70711 (+) | 228 | WP_003058873.1 | phage holin | - |
| VKP55_RS00485 (VKP55_00485) | - | 70827..72029 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| VKP55_RS00490 (VKP55_00490) | - | 72351..72866 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| VKP55_RS00495 (VKP55_00495) | - | 72980..73966 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| VKP55_RS00500 (VKP55_00500) | prx | 74190..74372 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| VKP55_RS00505 (VKP55_00505) | plsX | 74611..75618 (+) | 1008 | WP_002987696.1 | phosphate acyltransferase PlsX | - |
| VKP55_RS00510 (VKP55_00510) | - | 75611..75853 (+) | 243 | WP_002993445.1 | phosphopantetheine-binding protein | - |
| VKP55_RS00515 (VKP55_00515) | purC | 76004..76708 (+) | 705 | WP_028797123.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| VKP55_RS00520 (VKP55_00520) | - | 76832..80557 (+) | 3726 | WP_326674260.1 | phosphoribosylformylglycinamidine synthase | - |
| VKP55_RS00525 (VKP55_00525) | purF | 80718..82172 (+) | 1455 | WP_023080049.1 | amidophosphoribosyltransferase | - |
| VKP55_RS00530 (VKP55_00530) | purM | 82200..83222 (+) | 1023 | WP_326674262.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| VKP55_RS00535 (VKP55_00535) | purN | 83390..83944 (+) | 555 | WP_009880321.1 | phosphoribosylglycinamide formyltransferase | - |
| VKP55_RS00540 (VKP55_00540) | purH | 84128..85675 (+) | 1548 | WP_021733664.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| VKP55_RS00545 (VKP55_00545) | - | 85734..86858 (-) | 1125 | WP_002987712.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=925021 VKP55_RS00500 WP_011054856.1 74190..74372(+) (prx) [Streptococcus pyogenes strain SS1366]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=925021 VKP55_RS00500 WP_011054856.1 74190..74372(+) (prx) [Streptococcus pyogenes strain SS1366]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |