Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP56_RS04845 | Genome accession | NZ_CP142350 |
| Coordinates | 973990..974178 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain SS1445 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 966402..1016604 | 973990..974178 | within | 0 |
Gene organization within MGE regions
Location: 966402..1016604
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP56_RS04810 (VKP56_04810) | pfkA | 966402..967415 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| VKP56_RS04815 (VKP56_04815) | - | 967495..970605 (-) | 3111 | WP_326656481.1 | DNA polymerase III subunit alpha | - |
| VKP56_RS04820 (VKP56_04820) | - | 970790..971161 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| VKP56_RS04825 (VKP56_04825) | - | 971161..971859 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| VKP56_RS04830 (VKP56_04830) | - | 971869..972654 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| VKP56_RS04835 (VKP56_04835) | - | 972785..973399 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| VKP56_RS04845 (VKP56_04845) | prx | 973990..974178 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| VKP56_RS04850 (VKP56_04850) | spel | 974293..975081 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| VKP56_RS04855 (VKP56_04855) | spem | 975364..976077 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| VKP56_RS04860 (VKP56_04860) | - | 976461..977021 (-) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| VKP56_RS04865 (VKP56_04865) | - | 977054..977218 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| VKP56_RS04870 (VKP56_04870) | - | 977367..978572 (-) | 1206 | WP_326656485.1 | glucosaminidase domain-containing protein | - |
| VKP56_RS04875 (VKP56_04875) | - | 978688..978915 (-) | 228 | WP_136059203.1 | phage holin | - |
| VKP56_RS04880 (VKP56_04880) | - | 978912..979187 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| VKP56_RS04885 (VKP56_04885) | - | 979197..979814 (-) | 618 | WP_326656488.1 | DUF1366 domain-containing protein | - |
| VKP56_RS04890 (VKP56_04890) | - | 979817..980248 (-) | 432 | WP_136289646.1 | DUF1617 family protein | - |
| VKP56_RS04895 (VKP56_04895) | - | 980260..982146 (-) | 1887 | WP_326656492.1 | gp58-like family protein | - |
| VKP56_RS04900 (VKP56_04900) | hylP | 982161..983180 (-) | 1020 | WP_326656494.1 | hyaluronidase HylP | - |
| VKP56_RS04905 (VKP56_04905) | - | 983177..985315 (-) | 2139 | WP_326656496.1 | phage tail spike protein | - |
| VKP56_RS04910 (VKP56_04910) | - | 985296..986027 (-) | 732 | WP_326656498.1 | distal tail protein Dit | - |
| VKP56_RS04915 (VKP56_04915) | - | 986024..989284 (-) | 3261 | WP_326656500.1 | tape measure protein | - |
| VKP56_RS04920 (VKP56_04920) | - | 989274..989855 (-) | 582 | WP_326656502.1 | bacteriophage Gp15 family protein | - |
| VKP56_RS04925 (VKP56_04925) | - | 989859..990293 (-) | 435 | WP_326656504.1 | hypothetical protein | - |
| VKP56_RS04930 (VKP56_04930) | - | 990340..990798 (-) | 459 | WP_326656506.1 | phage tail tube protein | - |
| VKP56_RS04935 (VKP56_04935) | - | 990798..991196 (-) | 399 | WP_326656508.1 | minor capsid protein | - |
| VKP56_RS04940 (VKP56_04940) | - | 991193..991549 (-) | 357 | WP_002986818.1 | minor capsid protein | - |
| VKP56_RS04945 (VKP56_04945) | - | 991549..991881 (-) | 333 | WP_094751277.1 | minor capsid protein | - |
| VKP56_RS04950 (VKP56_04950) | - | 991871..992272 (-) | 402 | WP_201294413.1 | hypothetical protein | - |
| VKP56_RS04955 (VKP56_04955) | - | 992305..992574 (-) | 270 | WP_063629400.1 | HeH/LEM domain-containing protein | - |
| VKP56_RS04960 (VKP56_04960) | - | 992584..993420 (-) | 837 | WP_063629401.1 | N4-gp56 family major capsid protein | - |
| VKP56_RS04965 (VKP56_04965) | - | 993424..994038 (-) | 615 | WP_326656512.1 | hypothetical protein | - |
| VKP56_RS04970 (VKP56_04970) | - | 994164..994430 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| VKP56_RS04975 (VKP56_04975) | - | 994492..994731 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| VKP56_RS04980 (VKP56_04980) | - | 994703..996181 (-) | 1479 | WP_326656515.1 | phage minor capsid protein | - |
| VKP56_RS04985 (VKP56_04985) | - | 996186..997688 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| VKP56_RS04990 (VKP56_04990) | - | 997702..999002 (-) | 1301 | Protein_941 | PBSX family phage terminase large subunit | - |
| VKP56_RS04995 (VKP56_04995) | - | 998992..999468 (-) | 477 | WP_136107635.1 | terminase small subunit | - |
| VKP56_RS05000 (VKP56_05000) | - | 999532..1000404 (-) | 873 | WP_081281265.1 | hypothetical protein | - |
| VKP56_RS05005 (VKP56_05005) | - | 1000958..1001395 (-) | 438 | WP_326656523.1 | DUF1492 domain-containing protein | - |
| VKP56_RS05010 (VKP56_05010) | - | 1001758..1002294 (-) | 537 | WP_136297739.1 | DUF1642 domain-containing protein | - |
| VKP56_RS05015 (VKP56_05015) | - | 1002442..1002672 (-) | 231 | WP_409202114.1 | hypothetical protein | - |
| VKP56_RS05020 (VKP56_05020) | - | 1002711..1003115 (-) | 405 | WP_326656528.1 | YopX family protein | - |
| VKP56_RS05025 (VKP56_05025) | - | 1003112..1003306 (-) | 195 | WP_136297742.1 | hypothetical protein | - |
| VKP56_RS05030 (VKP56_05030) | - | 1003293..1003805 (-) | 513 | WP_136297743.1 | crossover junction endodeoxyribonuclease RuvC | - |
| VKP56_RS05035 (VKP56_05035) | - | 1003802..1004143 (-) | 342 | WP_326656532.1 | hypothetical protein | - |
| VKP56_RS05040 (VKP56_05040) | - | 1004319..1004486 (-) | 168 | WP_326656534.1 | hypothetical protein | - |
| VKP56_RS05045 (VKP56_05045) | - | 1004496..1005293 (-) | 798 | WP_326656536.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VKP56_RS05050 (VKP56_05050) | - | 1005290..1006270 (-) | 981 | WP_326656538.1 | RecT family recombinase | - |
| VKP56_RS05055 (VKP56_05055) | - | 1006273..1006602 (-) | 330 | WP_136297747.1 | hypothetical protein | - |
| VKP56_RS05060 (VKP56_05060) | - | 1006764..1006970 (-) | 207 | WP_136297748.1 | hypothetical protein | - |
| VKP56_RS05065 (VKP56_05065) | - | 1006979..1007119 (-) | 141 | WP_000166038.1 | hypothetical protein | - |
| VKP56_RS05070 (VKP56_05070) | - | 1007116..1007349 (-) | 234 | WP_046176838.1 | hypothetical protein | - |
| VKP56_RS05075 (VKP56_05075) | - | 1007330..1007713 (-) | 384 | WP_136297749.1 | DnaD domain-containing protein | - |
| VKP56_RS05080 (VKP56_05080) | - | 1007822..1008090 (-) | 269 | Protein_959 | transcriptional regulator | - |
| VKP56_RS05085 (VKP56_05085) | - | 1008190..1008375 (-) | 186 | WP_136297751.1 | hypothetical protein | - |
| VKP56_RS05090 (VKP56_05090) | - | 1008377..1008667 (-) | 291 | WP_136297752.1 | MerR family transcriptional regulator | - |
| VKP56_RS05095 (VKP56_05095) | - | 1008746..1008922 (-) | 177 | WP_136297753.1 | helix-turn-helix domain-containing protein | - |
| VKP56_RS05100 (VKP56_05100) | - | 1009063..1009284 (+) | 222 | WP_002992762.1 | hypothetical protein | - |
| VKP56_RS05105 (VKP56_05105) | - | 1009242..1009583 (-) | 342 | WP_326656555.1 | hypothetical protein | - |
| VKP56_RS05110 (VKP56_05110) | - | 1009629..1010435 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| VKP56_RS05115 (VKP56_05115) | - | 1010370..1010636 (-) | 267 | WP_136297755.1 | hypothetical protein | - |
| VKP56_RS05120 (VKP56_05120) | - | 1010668..1011429 (-) | 762 | WP_326656557.1 | phage antirepressor KilAC domain-containing protein | - |
| VKP56_RS05125 (VKP56_05125) | - | 1011442..1011654 (-) | 213 | WP_003051787.1 | helix-turn-helix domain-containing protein | - |
| VKP56_RS05130 (VKP56_05130) | - | 1011943..1012290 (+) | 348 | WP_136020123.1 | helix-turn-helix domain-containing protein | - |
| VKP56_RS05135 (VKP56_05135) | - | 1012294..1012680 (+) | 387 | WP_136020124.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VKP56_RS05140 (VKP56_05140) | - | 1012707..1013630 (+) | 924 | WP_136020125.1 | hypothetical protein | - |
| VKP56_RS05145 (VKP56_05145) | - | 1013641..1013985 (+) | 345 | WP_048327223.1 | STAS-like domain-containing protein | - |
| VKP56_RS05150 (VKP56_05150) | - | 1013975..1014499 (+) | 525 | WP_048327221.1 | type II toxin-antitoxin system VapC family toxin | - |
| VKP56_RS05155 (VKP56_05155) | - | 1014622..1015710 (+) | 1089 | WP_326656570.1 | tyrosine-type recombinase/integrase | - |
| VKP56_RS05160 (VKP56_05160) | - | 1015984..1016604 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=925001 VKP56_RS04845 WP_011054546.1 973990..974178(-) (prx) [Streptococcus pyogenes strain SS1445]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=925001 VKP56_RS04845 WP_011054546.1 973990..974178(-) (prx) [Streptococcus pyogenes strain SS1445]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTACGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTACGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |