NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	ABZO29_RS41745	Genome accession	NZ_CP160403
Coordinates	9140180..9140569 (-)	Length	129 a.a.
NCBI ID	WP_367325411.1	Uniprot ID	-
Organism	Streptomyces sp. HUAS ZL42
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 9135180..9145569

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABZO29_RS41720 (ABZO29_41720)	-	9136346..9137629 (+)	1284	WP_367325407.1	DUF6777 domain-containing protein	-
ABZO29_RS41725 (ABZO29_41725)	-	9137728..9138201 (+)	474	WP_367325408.1	ATP-binding protein	-
ABZO29_RS41730 (ABZO29_41730)	-	9138226..9139113 (-)	888	WP_367325409.1	RNA polymerase sigma factor SigF	-
ABZO29_RS41735 (ABZO29_41735)	-	9139386..9139805 (+)	420	WP_367325410.1	helix-turn-helix domain-containing protein	-
ABZO29_RS41740 (ABZO29_41740)	-	9139827..9140219 (-)	393	Protein_8253	ClpP family protease	-
ABZO29_RS41745 (ABZO29_41745)	clpP	9140180..9140569 (-)	390	WP_367325411.1	ATP-dependent Clp protease proteolytic subunit	Regulator
ABZO29_RS41750 (ABZO29_41750)	clpP	9140571..9141224 (-)	654	WP_367325412.1	ATP-dependent Clp protease proteolytic subunit	Regulator
ABZO29_RS41755 (ABZO29_41755)	-	9141349..9142623 (-)	1275	WP_367325413.1	RNA-guided endonuclease InsQ/TnpB family protein	-
ABZO29_RS41760 (ABZO29_41760)	-	9142884..9143069 (-)	186	Protein_8257	epoxide hydrolase	-
ABZO29_RS41765 (ABZO29_41765)	-	9143192..9143674 (+)	483	WP_367325414.1	VOC family protein	-
ABZO29_RS41770 (ABZO29_41770)	-	9143715..9144605 (-)	891	WP_367325415.1	aminoglycoside phosphotransferase family protein	-
ABZO29_RS41775 (ABZO29_41775)	-	9144658..9145569 (-)	912	WP_367325416.1	SGNH/GDSL hydrolase family protein	-

Sequence

Protein

Download Length: 129 a.a. Molecular weight: 13971.86 Da Isoelectric Point: 5.0642

                                >NTDB_id=918393 ABZO29_RS41745 WP_367325411.1 9140180..9140569(-) (clpP) [Streptomyces sp. HUAS ZL42]

MGTYTIPNVVERTPQGERSYDVFSRLLSERIIFLGTEIDDGVANVVIAQLLHLESAAPENEIAIYINSPGGSFTSLMAIY

DTMTYVQAPISTFCVGQAASTAAVLLAGGDPGRRFVVARSPRSWRSTTR

Nucleotide

Download Length: 390 bp

                                >NTDB_id=918393 ABZO29_RS41745 WP_367325411.1 9140180..9140569(-) (clpP) [Streptomyces sp. HUAS ZL42]

ATGGGGACCTACACGATTCCGAACGTCGTCGAGCGGACCCCGCAGGGCGAGCGGTCCTACGACGTGTTCAGCCGGCTGCT

GTCGGAGCGGATCATCTTCCTCGGCACCGAGATCGACGACGGCGTCGCCAACGTCGTCATCGCGCAACTCCTCCATCTGG

AGTCGGCGGCCCCGGAGAACGAGATCGCGATCTACATCAACTCCCCTGGTGGCTCGTTCACCTCGCTCATGGCGATCTAC

GACACGATGACGTACGTACAGGCTCCGATCTCGACGTTCTGCGTCGGTCAGGCGGCATCCACGGCGGCCGTGCTCCTGGC

CGGTGGGGATCCCGGGCGGCGGTTCGTCGTGGCTCGTTCACCTCGCTCATGGCGATCTACGACACGATGA

Domains

Predicted by InterProScan.

Clp protease (CLP_protease)

(15-120)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	55.652	89.147	0.496
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	52.174	89.147	0.465
clpP	Streptococcus pneumoniae Rx1	46.429	86.822	0.403
clpP	Streptococcus pyogenes JRS4	46.429	86.822	0.403
clpP	Streptococcus pyogenes MGAS315	46.429	86.822	0.403
clpP	Streptococcus pneumoniae D39	46.429	86.822	0.403
clpP	Streptococcus pneumoniae R6	46.429	86.822	0.403
clpP	Streptococcus pneumoniae TIGR4	46.429	86.822	0.403
clpP	Streptococcus mutans UA159	45.536	86.822	0.395
clpP	Streptococcus thermophilus LMG 18311	44.643	86.822	0.388
clpP	Streptococcus thermophilus LMD-9	44.643	86.822	0.388
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	42.105	88.372	0.372
clpP	Lactococcus lactis subsp. cremoris KW2	42.105	88.372	0.372

Detailed information NTG0918393