Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W45_RS07160 | Genome accession | NZ_CP140117 |
| Coordinates | 1408679..1408858 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain NV1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408679..1449295 | 1408679..1408858 | within | 0 |
Gene organization within MGE regions
Location: 1408679..1449295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W45_RS07160 (U2W45_07155) | prx | 1408679..1408858 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| U2W45_RS07165 (U2W45_07160) | sda1 | 1409097..1410269 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| U2W45_RS07170 (U2W45_07165) | - | 1410385..1411581 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| U2W45_RS07175 (U2W45_07170) | - | 1411692..1411877 (-) | 186 | WP_002988802.1 | holin | - |
| U2W45_RS07180 (U2W45_07175) | - | 1411874..1412173 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| U2W45_RS07185 (U2W45_07180) | - | 1412184..1412804 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| U2W45_RS07190 (U2W45_07185) | - | 1412807..1412968 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| U2W45_RS07195 (U2W45_07190) | - | 1412977..1414884 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| U2W45_RS07200 (U2W45_07195) | - | 1414895..1415530 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| U2W45_RS07205 (U2W45_07200) | - | 1415530..1416585 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| U2W45_RS07210 (U2W45_07205) | - | 1416582..1418564 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| U2W45_RS07215 (U2W45_07210) | - | 1418574..1419416 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| U2W45_RS07220 (U2W45_07215) | - | 1419428..1423810 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| U2W45_RS07225 (U2W45_07220) | - | 1423825..1424058 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| U2W45_RS07230 (U2W45_07225) | - | 1424133..1424588 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| U2W45_RS07235 (U2W45_07230) | - | 1424642..1425241 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| U2W45_RS07240 (U2W45_07235) | - | 1425253..1425612 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| U2W45_RS07245 (U2W45_07240) | - | 1425616..1425960 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| U2W45_RS07250 (U2W45_07245) | - | 1425957..1426235 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| U2W45_RS07255 (U2W45_07250) | - | 1426246..1426602 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| U2W45_RS07260 (U2W45_07255) | - | 1426614..1427501 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| U2W45_RS07265 (U2W45_07260) | - | 1427514..1428083 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| U2W45_RS07270 (U2W45_07265) | - | 1428239..1428505 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| U2W45_RS07275 (U2W45_07270) | - | 1428508..1428696 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| U2W45_RS07280 (U2W45_07275) | - | 1428727..1430172 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| U2W45_RS07285 (U2W45_07280) | - | 1430132..1431664 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| U2W45_RS07290 (U2W45_07285) | - | 1431680..1432957 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| U2W45_RS07295 (U2W45_07290) | - | 1432947..1433399 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| U2W45_RS07300 (U2W45_07295) | - | 1433489..1433905 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| U2W45_RS07305 (U2W45_07300) | - | 1433902..1434093 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| U2W45_RS07310 (U2W45_07305) | - | 1434083..1434934 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| U2W45_RS07315 (U2W45_07310) | - | 1434943..1435209 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| U2W45_RS07320 (U2W45_07315) | - | 1435206..1435373 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| U2W45_RS07325 (U2W45_07320) | - | 1435374..1436696 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| U2W45_RS07330 (U2W45_07325) | - | 1436693..1436968 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| U2W45_RS07335 (U2W45_07330) | - | 1437355..1439739 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| U2W45_RS07340 (U2W45_07335) | - | 1439744..1441666 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| U2W45_RS07345 (U2W45_07340) | - | 1441709..1442266 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| U2W45_RS07350 (U2W45_07345) | - | 1442277..1442675 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| U2W45_RS07355 (U2W45_07350) | - | 1442679..1443833 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| U2W45_RS07360 (U2W45_07355) | - | 1443833..1444132 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| U2W45_RS07365 (U2W45_07360) | - | 1444220..1444423 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| U2W45_RS07370 (U2W45_07365) | - | 1444569..1444955 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| U2W45_RS07375 (U2W45_07370) | - | 1444952..1445155 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| U2W45_RS07380 (U2W45_07375) | - | 1445148..1445318 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| U2W45_RS07385 (U2W45_07380) | - | 1445315..1445590 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| U2W45_RS07390 (U2W45_07385) | - | 1445652..1445867 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| U2W45_RS07395 (U2W45_07390) | - | 1445915..1446328 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| U2W45_RS07400 (U2W45_07395) | - | 1446309..1446464 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| U2W45_RS07405 (U2W45_07400) | - | 1446790..1447140 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| U2W45_RS07410 (U2W45_07405) | - | 1447154..1447537 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W45_RS07415 (U2W45_07410) | - | 1447548..1448099 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| U2W45_RS07420 (U2W45_07415) | - | 1448216..1449295 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=912842 U2W45_RS07160 WP_002988813.1 1408679..1408858(-) (prx) [Streptococcus pyogenes strain NV1]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=912842 U2W45_RS07160 WP_002988813.1 1408679..1408858(-) (prx) [Streptococcus pyogenes strain NV1]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |