Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W42_RS05880 | Genome accession | NZ_CP140116 |
| Coordinates | 1167877..1168059 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV27 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1167877..1202887 | 1167877..1168059 | within | 0 |
Gene organization within MGE regions
Location: 1167877..1202887
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W42_RS05880 (U2W42_05880) | prx | 1167877..1168059 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| U2W42_RS05885 (U2W42_05885) | sda3 | 1168298..1169098 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| U2W42_RS05890 (U2W42_05890) | - | 1169369..1169803 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| U2W42_RS05895 (U2W42_05895) | - | 1169873..1171078 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| U2W42_RS05900 (U2W42_05900) | - | 1171194..1171421 (-) | 228 | WP_003058873.1 | phage holin | - |
| U2W42_RS05905 (U2W42_05905) | - | 1171418..1171693 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| U2W42_RS05910 (U2W42_05910) | - | 1171703..1172320 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| U2W42_RS05915 (U2W42_05915) | - | 1172317..1172754 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| U2W42_RS05920 (U2W42_05920) | - | 1172766..1174634 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| U2W42_RS05925 (U2W42_05925) | - | 1174631..1175326 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| U2W42_RS05930 (U2W42_05930) | - | 1175323..1177680 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| U2W42_RS05935 (U2W42_05935) | - | 1177680..1178051 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| U2W42_RS05940 (U2W42_05940) | - | 1178066..1178329 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| U2W42_RS05945 (U2W42_05945) | - | 1178340..1178933 (-) | 594 | WP_010922456.1 | tail protein | - |
| U2W42_RS05950 (U2W42_05950) | - | 1178945..1179280 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| U2W42_RS05955 (U2W42_05955) | - | 1179281..1179517 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| U2W42_RS05960 (U2W42_05960) | - | 1179510..1179848 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| U2W42_RS05965 (U2W42_05965) | - | 1179808..1180230 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| U2W42_RS05970 (U2W42_05970) | - | 1180240..1180440 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| U2W42_RS05975 (U2W42_05975) | - | 1180440..1181351 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| U2W42_RS05980 (U2W42_05980) | - | 1181376..1181837 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| U2W42_RS05985 (U2W42_05985) | - | 1181918..1183333 (-) | 1416 | WP_011285619.1 | terminase | - |
| U2W42_RS05990 (U2W42_05990) | - | 1183443..1183709 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| U2W42_RS05995 (U2W42_05995) | - | 1183702..1183881 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| U2W42_RS06000 (U2W42_06000) | - | 1183931..1184155 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| U2W42_RS06005 (U2W42_06005) | - | 1184161..1185654 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| U2W42_RS06010 (U2W42_06010) | - | 1185647..1186915 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| U2W42_RS06015 (U2W42_06015) | - | 1186912..1187268 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| U2W42_RS06020 (U2W42_06020) | - | 1187417..1187761 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| U2W42_RS06025 (U2W42_06025) | - | 1187870..1188289 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| U2W42_RS06030 (U2W42_06030) | - | 1188557..1189192 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| U2W42_RS06035 (U2W42_06035) | - | 1189194..1189463 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| U2W42_RS06040 (U2W42_06040) | - | 1189547..1190059 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| U2W42_RS06045 (U2W42_06045) | - | 1190056..1190397 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| U2W42_RS06050 (U2W42_06050) | - | 1190575..1190742 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| U2W42_RS06055 (U2W42_06055) | - | 1190752..1191549 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| U2W42_RS06060 (U2W42_06060) | - | 1191546..1192475 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| U2W42_RS06065 (U2W42_06065) | - | 1192478..1192807 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| U2W42_RS06070 (U2W42_06070) | - | 1192863..1193069 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| U2W42_RS06075 (U2W42_06075) | - | 1193078..1193218 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| U2W42_RS06080 (U2W42_06080) | - | 1193215..1193448 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| U2W42_RS06085 (U2W42_06085) | - | 1193429..1193818 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| U2W42_RS06090 (U2W42_06090) | - | 1193963..1194202 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| U2W42_RS06095 (U2W42_06095) | - | 1194302..1194487 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| U2W42_RS06100 (U2W42_06100) | - | 1194489..1194800 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| U2W42_RS06105 (U2W42_06105) | - | 1194878..1195063 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| U2W42_RS06110 (U2W42_06110) | - | 1195230..1195469 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| U2W42_RS06115 (U2W42_06115) | - | 1195611..1196417 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| U2W42_RS06120 (U2W42_06120) | - | 1196352..1196618 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| U2W42_RS06125 (U2W42_06125) | - | 1196650..1197366 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| U2W42_RS06130 (U2W42_06130) | - | 1197378..1197569 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| U2W42_RS06135 (U2W42_06135) | - | 1198205..1198300 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| U2W42_RS06140 (U2W42_06140) | - | 1198723..1199070 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| U2W42_RS06145 (U2W42_06145) | - | 1199074..1199454 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W42_RS06150 (U2W42_06150) | - | 1199466..1199732 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| U2W42_RS06155 (U2W42_06155) | - | 1199856..1200998 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| U2W42_RS06160 (U2W42_06160) | - | 1201088..1201363 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| U2W42_RS06165 (U2W42_06165) | - | 1201462..1202049 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| U2W42_RS06170 (U2W42_06170) | - | 1202027..1202869 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=912779 U2W42_RS05880 WP_011017964.1 1167877..1168059(-) (prx) [Streptococcus pyogenes strain NV27]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=912779 U2W42_RS05880 WP_011017964.1 1167877..1168059(-) (prx) [Streptococcus pyogenes strain NV27]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |