Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W42_RS05035 | Genome accession | NZ_CP140116 |
| Coordinates | 1006141..1006329 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV27 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 998557..1044867 | 1006141..1006329 | within | 0 |
Gene organization within MGE regions
Location: 998557..1044867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W42_RS05000 (U2W42_05000) | pfkA | 998557..999570 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| U2W42_RS05005 (U2W42_05005) | - | 999650..1002760 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| U2W42_RS05010 (U2W42_05010) | - | 1002945..1003316 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| U2W42_RS05015 (U2W42_05015) | - | 1003316..1004014 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| U2W42_RS05020 (U2W42_05020) | - | 1004024..1004809 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| U2W42_RS05025 (U2W42_05025) | - | 1004936..1005550 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| U2W42_RS05035 (U2W42_05035) | prx | 1006141..1006329 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| U2W42_RS05040 (U2W42_05040) | speA | 1006549..1007304 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| U2W42_RS05045 (U2W42_05045) | - | 1007426..1008085 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| U2W42_RS05050 (U2W42_05050) | - | 1008085..1008306 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| U2W42_RS05055 (U2W42_05055) | - | 1008316..1009089 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| U2W42_RS05060 (U2W42_05060) | - | 1009100..1009702 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| U2W42_RS05065 (U2W42_05065) | - | 1009714..1010478 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| U2W42_RS05070 (U2W42_05070) | - | 1010480..1010812 (-) | 333 | WP_011285562.1 | phage holin | - |
| U2W42_RS05075 (U2W42_05075) | - | 1010812..1011135 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| U2W42_RS05080 (U2W42_05080) | - | 1011149..1011271 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| U2W42_RS05085 (U2W42_05085) | - | 1011285..1011632 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| U2W42_RS05090 (U2W42_05090) | - | 1011643..1013505 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| U2W42_RS05095 (U2W42_05095) | - | 1013510..1016950 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| U2W42_RS05100 (U2W42_05100) | - | 1016951..1018435 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| U2W42_RS05105 (U2W42_05105) | - | 1018436..1020241 (-) | 1806 | WP_011054802.1 | tail protein | - |
| U2W42_RS05110 (U2W42_05110) | - | 1020234..1020692 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| U2W42_RS05115 (U2W42_05115) | - | 1020665..1020982 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| U2W42_RS05120 (U2W42_05120) | - | 1020995..1021501 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| U2W42_RS05125 (U2W42_05125) | - | 1021513..1021923 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| U2W42_RS05130 (U2W42_05130) | - | 1021925..1022320 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| U2W42_RS05135 (U2W42_05135) | - | 1022317..1022628 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| U2W42_RS05140 (U2W42_05140) | - | 1022625..1022969 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| U2W42_RS05145 (U2W42_05145) | - | 1022983..1023276 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| U2W42_RS05150 (U2W42_05150) | - | 1023289..1024179 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| U2W42_RS05155 (U2W42_05155) | - | 1024198..1024767 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| U2W42_RS05160 (U2W42_05160) | - | 1024876..1025010 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| U2W42_RS05165 (U2W42_05165) | - | 1025012..1025281 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| U2W42_RS05170 (U2W42_05170) | - | 1025288..1026196 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| U2W42_RS05175 (U2W42_05175) | - | 1026165..1027490 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| U2W42_RS05180 (U2W42_05180) | - | 1027490..1028764 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| U2W42_RS05185 (U2W42_05185) | - | 1028754..1029134 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| U2W42_RS05190 (U2W42_05190) | - | 1029744..1030178 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| U2W42_RS05195 (U2W42_05195) | - | 1030464..1030730 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| U2W42_RS05200 (U2W42_05200) | - | 1030727..1031251 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| U2W42_RS05205 (U2W42_05205) | - | 1031254..1031886 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| U2W42_RS05210 (U2W42_05210) | - | 1031888..1032172 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| U2W42_RS05215 (U2W42_05215) | - | 1032169..1032339 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| U2W42_RS05220 (U2W42_05220) | - | 1032336..1032572 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| U2W42_RS05225 (U2W42_05225) | - | 1032572..1032817 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| U2W42_RS05230 (U2W42_05230) | - | 1032814..1033170 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| U2W42_RS05235 (U2W42_05235) | - | 1033167..1033607 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| U2W42_RS05240 (U2W42_05240) | - | 1033607..1033810 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| U2W42_RS05245 (U2W42_05245) | ssb | 1033816..1034241 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| U2W42_RS05250 (U2W42_05250) | - | 1034234..1034908 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| U2W42_RS05255 (U2W42_05255) | - | 1034909..1035391 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| U2W42_RS05260 (U2W42_05260) | - | 1035413..1035667 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| U2W42_RS05265 (U2W42_05265) | - | 1035648..1036001 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| U2W42_RS05270 (U2W42_05270) | - | 1036142..1036924 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| U2W42_RS05275 (U2W42_05275) | - | 1036911..1037741 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U2W42_RS05280 (U2W42_05280) | - | 1037755..1037943 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| U2W42_RS05285 (U2W42_05285) | - | 1038177..1038416 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| U2W42_RS05290 (U2W42_05290) | - | 1038547..1038756 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| U2W42_RS05295 (U2W42_05295) | - | 1038866..1039066 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| U2W42_RS05300 (U2W42_05300) | - | 1039140..1039526 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| U2W42_RS05305 (U2W42_05305) | - | 1039515..1039724 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| U2W42_RS05310 (U2W42_05310) | - | 1039778..1040377 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| U2W42_RS05315 (U2W42_05315) | - | 1040407..1040565 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| U2W42_RS05320 (U2W42_05320) | - | 1040922..1041746 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| U2W42_RS05325 (U2W42_05325) | - | 1041782..1042675 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| U2W42_RS05330 (U2W42_05330) | - | 1042796..1043884 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| U2W42_RS05335 (U2W42_05335) | - | 1044247..1044867 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=912775 U2W42_RS05035 WP_011285559.1 1006141..1006329(-) (prx) [Streptococcus pyogenes strain NV27]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=912775 U2W42_RS05035 WP_011285559.1 1006141..1006329(-) (prx) [Streptococcus pyogenes strain NV27]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |