Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W44_RS05875 | Genome accession | NZ_CP140114 |
| Coordinates | 1167635..1167817 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1167635..1202645 | 1167635..1167817 | within | 0 |
Gene organization within MGE regions
Location: 1167635..1202645
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W44_RS05875 (U2W44_05875) | prx | 1167635..1167817 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| U2W44_RS05880 (U2W44_05880) | sda3 | 1168056..1168856 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| U2W44_RS05885 (U2W44_05885) | - | 1169127..1169561 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| U2W44_RS05890 (U2W44_05890) | - | 1169631..1170836 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| U2W44_RS05895 (U2W44_05895) | - | 1170952..1171179 (-) | 228 | WP_003058873.1 | phage holin | - |
| U2W44_RS05900 (U2W44_05900) | - | 1171176..1171451 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| U2W44_RS05905 (U2W44_05905) | - | 1171461..1172078 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| U2W44_RS05910 (U2W44_05910) | - | 1172075..1172512 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| U2W44_RS05915 (U2W44_05915) | - | 1172524..1174392 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| U2W44_RS05920 (U2W44_05920) | - | 1174389..1175084 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| U2W44_RS05925 (U2W44_05925) | - | 1175081..1177438 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| U2W44_RS05930 (U2W44_05930) | - | 1177438..1177809 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| U2W44_RS05935 (U2W44_05935) | - | 1177824..1178087 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| U2W44_RS05940 (U2W44_05940) | - | 1178098..1178691 (-) | 594 | WP_010922456.1 | tail protein | - |
| U2W44_RS05945 (U2W44_05945) | - | 1178703..1179038 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| U2W44_RS05950 (U2W44_05950) | - | 1179039..1179275 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| U2W44_RS05955 (U2W44_05955) | - | 1179268..1179606 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| U2W44_RS05960 (U2W44_05960) | - | 1179566..1179988 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| U2W44_RS05965 (U2W44_05965) | - | 1179998..1180198 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| U2W44_RS05970 (U2W44_05970) | - | 1180198..1181109 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| U2W44_RS05975 (U2W44_05975) | - | 1181134..1181595 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| U2W44_RS05980 (U2W44_05980) | - | 1181676..1183091 (-) | 1416 | WP_011285619.1 | terminase | - |
| U2W44_RS05985 (U2W44_05985) | - | 1183201..1183467 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| U2W44_RS05990 (U2W44_05990) | - | 1183460..1183639 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| U2W44_RS05995 (U2W44_05995) | - | 1183689..1183913 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| U2W44_RS06000 (U2W44_06000) | - | 1183919..1185412 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| U2W44_RS06005 (U2W44_06005) | - | 1185405..1186673 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| U2W44_RS06010 (U2W44_06010) | - | 1186670..1187026 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| U2W44_RS06015 (U2W44_06015) | - | 1187175..1187519 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| U2W44_RS06020 (U2W44_06020) | - | 1187628..1188047 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| U2W44_RS06025 (U2W44_06025) | - | 1188315..1188950 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| U2W44_RS06030 (U2W44_06030) | - | 1188952..1189221 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| U2W44_RS06035 (U2W44_06035) | - | 1189305..1189817 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| U2W44_RS06040 (U2W44_06040) | - | 1189814..1190155 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| U2W44_RS06045 (U2W44_06045) | - | 1190333..1190500 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| U2W44_RS06050 (U2W44_06050) | - | 1190510..1191307 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| U2W44_RS06055 (U2W44_06055) | - | 1191304..1192233 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| U2W44_RS06060 (U2W44_06060) | - | 1192236..1192565 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| U2W44_RS06065 (U2W44_06065) | - | 1192621..1192827 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| U2W44_RS06070 (U2W44_06070) | - | 1192836..1192976 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| U2W44_RS06075 (U2W44_06075) | - | 1192973..1193206 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| U2W44_RS06080 (U2W44_06080) | - | 1193187..1193576 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| U2W44_RS06085 (U2W44_06085) | - | 1193721..1193960 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| U2W44_RS06090 (U2W44_06090) | - | 1194060..1194245 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| U2W44_RS06095 (U2W44_06095) | - | 1194247..1194558 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| U2W44_RS06100 (U2W44_06100) | - | 1194636..1194821 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| U2W44_RS06105 (U2W44_06105) | - | 1194988..1195227 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| U2W44_RS06110 (U2W44_06110) | - | 1195369..1196175 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| U2W44_RS06115 (U2W44_06115) | - | 1196110..1196376 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| U2W44_RS06120 (U2W44_06120) | - | 1196408..1197124 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| U2W44_RS06125 (U2W44_06125) | - | 1197136..1197327 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| U2W44_RS06130 (U2W44_06130) | - | 1197963..1198058 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| U2W44_RS06135 (U2W44_06135) | - | 1198481..1198828 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| U2W44_RS06140 (U2W44_06140) | - | 1198832..1199212 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W44_RS06145 (U2W44_06145) | - | 1199224..1199490 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| U2W44_RS06150 (U2W44_06150) | - | 1199614..1200756 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| U2W44_RS06155 (U2W44_06155) | - | 1200846..1201121 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| U2W44_RS06160 (U2W44_06160) | - | 1201220..1201807 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| U2W44_RS06165 (U2W44_06165) | - | 1201785..1202627 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=912723 U2W44_RS05875 WP_011017964.1 1167635..1167817(-) (prx) [Streptococcus pyogenes strain NV6]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=912723 U2W44_RS05875 WP_011017964.1 1167635..1167817(-) (prx) [Streptococcus pyogenes strain NV6]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |