Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W44_RS05030 | Genome accession | NZ_CP140114 |
| Coordinates | 1005894..1006082 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 998311..1044620 | 1005894..1006082 | within | 0 |
Gene organization within MGE regions
Location: 998311..1044620
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W44_RS04995 (U2W44_04995) | pfkA | 998311..999324 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| U2W44_RS05000 (U2W44_05000) | - | 999404..1002513 (-) | 3110 | Protein_941 | DNA polymerase III subunit alpha | - |
| U2W44_RS05005 (U2W44_05005) | - | 1002698..1003069 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| U2W44_RS05010 (U2W44_05010) | - | 1003069..1003767 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| U2W44_RS05015 (U2W44_05015) | - | 1003777..1004562 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| U2W44_RS05020 (U2W44_05020) | - | 1004689..1005303 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| U2W44_RS05030 (U2W44_05030) | prx | 1005894..1006082 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| U2W44_RS05035 (U2W44_05035) | speA | 1006302..1007057 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| U2W44_RS05040 (U2W44_05040) | - | 1007179..1007838 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| U2W44_RS05045 (U2W44_05045) | - | 1007838..1008059 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| U2W44_RS05050 (U2W44_05050) | - | 1008069..1008842 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| U2W44_RS05055 (U2W44_05055) | - | 1008853..1009455 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| U2W44_RS05060 (U2W44_05060) | - | 1009467..1010231 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| U2W44_RS05065 (U2W44_05065) | - | 1010233..1010565 (-) | 333 | WP_011285562.1 | phage holin | - |
| U2W44_RS05070 (U2W44_05070) | - | 1010565..1010888 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| U2W44_RS05075 (U2W44_05075) | - | 1010902..1011024 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| U2W44_RS05080 (U2W44_05080) | - | 1011038..1011385 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| U2W44_RS05085 (U2W44_05085) | - | 1011396..1013258 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| U2W44_RS05090 (U2W44_05090) | - | 1013263..1016703 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| U2W44_RS05095 (U2W44_05095) | - | 1016704..1018188 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| U2W44_RS05100 (U2W44_05100) | - | 1018189..1019994 (-) | 1806 | WP_011054802.1 | tail protein | - |
| U2W44_RS05105 (U2W44_05105) | - | 1019987..1020445 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| U2W44_RS05110 (U2W44_05110) | - | 1020418..1020735 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| U2W44_RS05115 (U2W44_05115) | - | 1020748..1021254 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| U2W44_RS05120 (U2W44_05120) | - | 1021266..1021676 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| U2W44_RS05125 (U2W44_05125) | - | 1021678..1022073 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| U2W44_RS05130 (U2W44_05130) | - | 1022070..1022381 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| U2W44_RS05135 (U2W44_05135) | - | 1022378..1022722 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| U2W44_RS05140 (U2W44_05140) | - | 1022736..1023029 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| U2W44_RS05145 (U2W44_05145) | - | 1023042..1023932 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| U2W44_RS05150 (U2W44_05150) | - | 1023951..1024520 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| U2W44_RS05155 (U2W44_05155) | - | 1024629..1024763 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| U2W44_RS05160 (U2W44_05160) | - | 1024765..1025034 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| U2W44_RS05165 (U2W44_05165) | - | 1025041..1025949 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| U2W44_RS05170 (U2W44_05170) | - | 1025918..1027243 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| U2W44_RS05175 (U2W44_05175) | - | 1027243..1028517 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| U2W44_RS05180 (U2W44_05180) | - | 1028507..1028887 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| U2W44_RS05185 (U2W44_05185) | - | 1029497..1029931 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| U2W44_RS05190 (U2W44_05190) | - | 1030217..1030483 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| U2W44_RS05195 (U2W44_05195) | - | 1030480..1031004 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| U2W44_RS05200 (U2W44_05200) | - | 1031007..1031639 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| U2W44_RS05205 (U2W44_05205) | - | 1031641..1031925 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| U2W44_RS05210 (U2W44_05210) | - | 1031922..1032092 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| U2W44_RS05215 (U2W44_05215) | - | 1032089..1032325 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| U2W44_RS05220 (U2W44_05220) | - | 1032325..1032570 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| U2W44_RS05225 (U2W44_05225) | - | 1032567..1032923 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| U2W44_RS05230 (U2W44_05230) | - | 1032920..1033360 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| U2W44_RS05235 (U2W44_05235) | - | 1033360..1033563 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| U2W44_RS05240 (U2W44_05240) | ssb | 1033569..1033994 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| U2W44_RS05245 (U2W44_05245) | - | 1033987..1034661 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| U2W44_RS05250 (U2W44_05250) | - | 1034662..1035144 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| U2W44_RS05255 (U2W44_05255) | - | 1035166..1035420 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| U2W44_RS05260 (U2W44_05260) | - | 1035401..1035754 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| U2W44_RS05265 (U2W44_05265) | - | 1035895..1036677 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| U2W44_RS05270 (U2W44_05270) | - | 1036664..1037494 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U2W44_RS05275 (U2W44_05275) | - | 1037508..1037696 (-) | 189 | Protein_995 | XRE family transcriptional regulator | - |
| U2W44_RS05280 (U2W44_05280) | - | 1037930..1038169 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| U2W44_RS05285 (U2W44_05285) | - | 1038300..1038509 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| U2W44_RS05290 (U2W44_05290) | - | 1038619..1038819 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| U2W44_RS05295 (U2W44_05295) | - | 1038893..1039279 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| U2W44_RS05300 (U2W44_05300) | - | 1039268..1039477 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| U2W44_RS05305 (U2W44_05305) | - | 1039531..1040130 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| U2W44_RS05310 (U2W44_05310) | - | 1040160..1040318 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| U2W44_RS05315 (U2W44_05315) | - | 1040675..1041499 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| U2W44_RS05320 (U2W44_05320) | - | 1041535..1042428 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| U2W44_RS05325 (U2W44_05325) | - | 1042549..1043637 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| U2W44_RS05330 (U2W44_05330) | - | 1044000..1044620 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=912719 U2W44_RS05030 WP_011285559.1 1005894..1006082(-) (prx) [Streptococcus pyogenes strain NV6]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=912719 U2W44_RS05030 WP_011285559.1 1005894..1006082(-) (prx) [Streptococcus pyogenes strain NV6]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |