Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W41_RS07155 | Genome accession | NZ_CP140113 |
| Coordinates | 1406450..1406629 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain NV28 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1406450..1447066 | 1406450..1406629 | within | 0 |
Gene organization within MGE regions
Location: 1406450..1447066
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W41_RS07155 (U2W41_07155) | prx | 1406450..1406629 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| U2W41_RS07160 (U2W41_07160) | sda1 | 1406868..1408040 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| U2W41_RS07165 (U2W41_07165) | - | 1408156..1409352 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| U2W41_RS07170 (U2W41_07170) | - | 1409463..1409648 (-) | 186 | WP_002988802.1 | holin | - |
| U2W41_RS07175 (U2W41_07175) | - | 1409645..1409944 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| U2W41_RS07180 (U2W41_07180) | - | 1409955..1410575 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| U2W41_RS07185 (U2W41_07185) | - | 1410578..1410739 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| U2W41_RS07190 (U2W41_07190) | - | 1410748..1412655 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| U2W41_RS07195 (U2W41_07195) | - | 1412666..1413301 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| U2W41_RS07200 (U2W41_07200) | - | 1413301..1414356 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| U2W41_RS07205 (U2W41_07205) | - | 1414353..1416335 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| U2W41_RS07210 (U2W41_07210) | - | 1416345..1417187 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| U2W41_RS07215 (U2W41_07215) | - | 1417199..1421581 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| U2W41_RS07220 (U2W41_07220) | - | 1421596..1421829 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| U2W41_RS07225 (U2W41_07225) | - | 1421904..1422359 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| U2W41_RS07230 (U2W41_07230) | - | 1422413..1423012 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| U2W41_RS07235 (U2W41_07235) | - | 1423024..1423383 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| U2W41_RS07240 (U2W41_07240) | - | 1423387..1423731 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| U2W41_RS07245 (U2W41_07245) | - | 1423728..1424006 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| U2W41_RS07250 (U2W41_07250) | - | 1424017..1424373 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| U2W41_RS07255 (U2W41_07255) | - | 1424385..1425272 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| U2W41_RS07260 (U2W41_07260) | - | 1425285..1425854 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| U2W41_RS07265 (U2W41_07265) | - | 1426010..1426276 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| U2W41_RS07270 (U2W41_07270) | - | 1426279..1426467 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| U2W41_RS07275 (U2W41_07275) | - | 1426498..1427943 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| U2W41_RS07280 (U2W41_07280) | - | 1427903..1429435 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| U2W41_RS07285 (U2W41_07285) | - | 1429451..1430728 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| U2W41_RS07290 (U2W41_07290) | - | 1430718..1431170 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| U2W41_RS07295 (U2W41_07295) | - | 1431260..1431676 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| U2W41_RS07300 (U2W41_07300) | - | 1431673..1431864 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| U2W41_RS07305 (U2W41_07305) | - | 1431854..1432705 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| U2W41_RS07310 (U2W41_07310) | - | 1432714..1432980 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| U2W41_RS07315 (U2W41_07315) | - | 1432977..1433144 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| U2W41_RS07320 (U2W41_07320) | - | 1433145..1434467 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| U2W41_RS07325 (U2W41_07325) | - | 1434464..1434739 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| U2W41_RS07330 (U2W41_07330) | - | 1435126..1437510 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| U2W41_RS07335 (U2W41_07335) | - | 1437515..1439437 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| U2W41_RS07340 (U2W41_07340) | - | 1439480..1440037 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| U2W41_RS07345 (U2W41_07345) | - | 1440048..1440446 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| U2W41_RS07350 (U2W41_07350) | - | 1440450..1441604 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| U2W41_RS07355 (U2W41_07355) | - | 1441604..1441903 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| U2W41_RS07360 (U2W41_07360) | - | 1441991..1442194 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| U2W41_RS07365 (U2W41_07365) | - | 1442340..1442726 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| U2W41_RS07370 (U2W41_07370) | - | 1442723..1442926 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| U2W41_RS07375 (U2W41_07375) | - | 1442919..1443089 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| U2W41_RS07380 (U2W41_07380) | - | 1443086..1443361 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| U2W41_RS07385 (U2W41_07385) | - | 1443423..1443638 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| U2W41_RS07390 (U2W41_07390) | - | 1443686..1444099 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| U2W41_RS07395 (U2W41_07395) | - | 1444080..1444235 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| U2W41_RS07400 (U2W41_07400) | - | 1444561..1444911 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| U2W41_RS07405 (U2W41_07405) | - | 1444925..1445308 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W41_RS07410 (U2W41_07410) | - | 1445319..1445870 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| U2W41_RS07415 (U2W41_07415) | - | 1445987..1447066 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=912674 U2W41_RS07155 WP_002988813.1 1406450..1406629(-) (prx) [Streptococcus pyogenes strain NV28]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=912674 U2W41_RS07155 WP_002988813.1 1406450..1406629(-) (prx) [Streptococcus pyogenes strain NV28]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |