Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W41_RS05885 | Genome accession | NZ_CP140113 |
| Coordinates | 1166775..1166957 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV28 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1166775..1201785 | 1166775..1166957 | within | 0 |
Gene organization within MGE regions
Location: 1166775..1201785
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W41_RS05885 (U2W41_05885) | prx | 1166775..1166957 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| U2W41_RS05890 (U2W41_05890) | sda3 | 1167196..1167996 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| U2W41_RS05895 (U2W41_05895) | - | 1168267..1168701 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| U2W41_RS05900 (U2W41_05900) | - | 1168771..1169976 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| U2W41_RS05905 (U2W41_05905) | - | 1170092..1170319 (-) | 228 | WP_003058873.1 | phage holin | - |
| U2W41_RS05910 (U2W41_05910) | - | 1170316..1170591 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| U2W41_RS05915 (U2W41_05915) | - | 1170601..1171218 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| U2W41_RS05920 (U2W41_05920) | - | 1171215..1171652 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| U2W41_RS05925 (U2W41_05925) | - | 1171664..1173532 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| U2W41_RS05930 (U2W41_05930) | - | 1173529..1174224 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| U2W41_RS05935 (U2W41_05935) | - | 1174221..1176578 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| U2W41_RS05940 (U2W41_05940) | - | 1176578..1176949 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| U2W41_RS05945 (U2W41_05945) | - | 1176964..1177227 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| U2W41_RS05950 (U2W41_05950) | - | 1177238..1177831 (-) | 594 | WP_010922456.1 | tail protein | - |
| U2W41_RS05955 (U2W41_05955) | - | 1177843..1178178 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| U2W41_RS05960 (U2W41_05960) | - | 1178179..1178415 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| U2W41_RS05965 (U2W41_05965) | - | 1178408..1178746 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| U2W41_RS05970 (U2W41_05970) | - | 1178706..1179128 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| U2W41_RS05975 (U2W41_05975) | - | 1179138..1179338 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| U2W41_RS05980 (U2W41_05980) | - | 1179338..1180249 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| U2W41_RS05985 (U2W41_05985) | - | 1180274..1180735 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| U2W41_RS05990 (U2W41_05990) | - | 1180816..1182231 (-) | 1416 | WP_011285619.1 | terminase | - |
| U2W41_RS05995 (U2W41_05995) | - | 1182341..1182607 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| U2W41_RS06000 (U2W41_06000) | - | 1182600..1182779 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| U2W41_RS06005 (U2W41_06005) | - | 1182829..1183053 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| U2W41_RS06010 (U2W41_06010) | - | 1183059..1184552 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| U2W41_RS06015 (U2W41_06015) | - | 1184545..1185813 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| U2W41_RS06020 (U2W41_06020) | - | 1185810..1186166 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| U2W41_RS06025 (U2W41_06025) | - | 1186315..1186659 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| U2W41_RS06030 (U2W41_06030) | - | 1186768..1187187 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| U2W41_RS06035 (U2W41_06035) | - | 1187455..1188090 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| U2W41_RS06040 (U2W41_06040) | - | 1188092..1188361 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| U2W41_RS06045 (U2W41_06045) | - | 1188445..1188957 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| U2W41_RS06050 (U2W41_06050) | - | 1188954..1189295 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| U2W41_RS06055 (U2W41_06055) | - | 1189473..1189640 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| U2W41_RS06060 (U2W41_06060) | - | 1189650..1190447 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| U2W41_RS06065 (U2W41_06065) | - | 1190444..1191373 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| U2W41_RS06070 (U2W41_06070) | - | 1191376..1191705 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| U2W41_RS06075 (U2W41_06075) | - | 1191761..1191967 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| U2W41_RS06080 (U2W41_06080) | - | 1191976..1192116 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| U2W41_RS06085 (U2W41_06085) | - | 1192113..1192346 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| U2W41_RS06090 (U2W41_06090) | - | 1192327..1192716 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| U2W41_RS06095 (U2W41_06095) | - | 1192861..1193100 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| U2W41_RS06100 (U2W41_06100) | - | 1193200..1193385 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| U2W41_RS06105 (U2W41_06105) | - | 1193387..1193698 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| U2W41_RS06110 (U2W41_06110) | - | 1193776..1193961 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| U2W41_RS06115 (U2W41_06115) | - | 1194128..1194367 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| U2W41_RS06120 (U2W41_06120) | - | 1194509..1195315 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| U2W41_RS06125 (U2W41_06125) | - | 1195250..1195516 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| U2W41_RS06130 (U2W41_06130) | - | 1195548..1196264 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| U2W41_RS06135 (U2W41_06135) | - | 1196276..1196467 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| U2W41_RS06140 (U2W41_06140) | - | 1197103..1197198 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| U2W41_RS06145 (U2W41_06145) | - | 1197621..1197968 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| U2W41_RS06150 (U2W41_06150) | - | 1197972..1198352 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W41_RS06155 (U2W41_06155) | - | 1198364..1198630 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| U2W41_RS06160 (U2W41_06160) | - | 1198754..1199896 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| U2W41_RS06165 (U2W41_06165) | - | 1199986..1200261 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| U2W41_RS06170 (U2W41_06170) | - | 1200360..1200947 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| U2W41_RS06175 (U2W41_06175) | - | 1200925..1201767 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=912667 U2W41_RS05885 WP_011017964.1 1166775..1166957(-) (prx) [Streptococcus pyogenes strain NV28]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=912667 U2W41_RS05885 WP_011017964.1 1166775..1166957(-) (prx) [Streptococcus pyogenes strain NV28]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |