Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SE861_RS03100 | Genome accession | NZ_CP138371 |
| Coordinates | 567766..567954 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain R31-snf2 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 558980..567724 | 567766..567954 | flank | 42 |
| IS/Tn | 566810..567310 | 567766..567954 | flank | 456 |
Gene organization within MGE regions
Location: 558980..567954
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE861_RS03060 (SE861_03060) | - | 560359..560520 (-) | 162 | WP_079262691.1 | TM2 domain-containing protein | - |
| SE861_RS03065 (SE861_03065) | - | 561263..562540 (+) | 1278 | WP_000594357.1 | ABC transporter permease | - |
| SE861_RS03070 (SE861_03070) | - | 562550..563206 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| SE861_RS03075 (SE861_03075) | - | 563206..564582 (+) | 1377 | WP_000594356.1 | ABC transporter permease | - |
| SE861_RS03080 (SE861_03080) | - | 564679..565332 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| SE861_RS03085 (SE861_03085) | - | 565329..566648 (+) | 1320 | WP_000734173.1 | HAMP domain-containing sensor histidine kinase | - |
| SE861_RS03090 (SE861_03090) | - | 566700..567346 (-) | 647 | Protein_527 | IS3 family transposase | - |
| SE861_RS03095 (SE861_03095) | - | 567524..567724 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| SE861_RS03100 (SE861_03100) | prx | 567766..567954 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=902446 SE861_RS03100 WP_000027835.1 567766..567954(+) (prx) [Streptococcus agalactiae strain R31-snf2]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=902446 SE861_RS03100 WP_000027835.1 567766..567954(+) (prx) [Streptococcus agalactiae strain R31-snf2]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |