Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SE933_RS10300 | Genome accession | NZ_CP138370 |
| Coordinates | 2024675..2024863 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SagR40 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2025298..2034052 | 2024675..2024863 | flank | 435 |
| IS/Tn | 2025298..2025909 | 2024675..2024863 | flank | 435 |
Gene organization within MGE regions
Location: 2024675..2034052
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE933_RS10300 (SE933_10300) | prx | 2024675..2024863 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| SE933_RS10305 (SE933_10305) | - | 2024905..2025084 (-) | 180 | WP_000076709.1 | CsbD family protein | - |
| SE933_RS10310 (SE933_10310) | - | 2025262..2025909 (+) | 648 | Protein_1961 | IS3 family transposase | - |
| SE933_RS10315 (SE933_10315) | - | 2025961..2027262 (-) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| SE933_RS10320 (SE933_10320) | - | 2027259..2027912 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| SE933_RS10325 (SE933_10325) | - | 2028009..2029384 (-) | 1376 | Protein_1964 | ABC transporter permease | - |
| SE933_RS10330 (SE933_10330) | - | 2029384..2030040 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| SE933_RS10335 (SE933_10335) | - | 2030050..2031327 (-) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| SE933_RS10340 (SE933_10340) | - | 2032069..2032230 (+) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| SE933_RS10345 (SE933_10345) | - | 2032403..2033780 (-) | 1378 | Protein_1968 | IS3 family transposase | - |
| SE933_RS10350 (SE933_10350) | - | 2033786..2034052 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=902421 SE933_RS10300 WP_000027835.1 2024675..2024863(-) (prx) [Streptococcus agalactiae strain SagR40]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=902421 SE933_RS10300 WP_000027835.1 2024675..2024863(-) (prx) [Streptococcus agalactiae strain SagR40]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |