Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SE858_RS07275 | Genome accession | NZ_CP138368 |
| Coordinates | 1413368..1413556 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SagR92 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1404582..1413326 | 1413368..1413556 | flank | 42 |
| IS/Tn | 1412301..1412912 | 1413368..1413556 | flank | 456 |
Gene organization within MGE regions
Location: 1404582..1413556
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE858_RS07235 (SE858_07235) | - | 1405961..1406122 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| SE858_RS07240 (SE858_07240) | - | 1406864..1408141 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| SE858_RS07245 (SE858_07245) | - | 1408151..1408807 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| SE858_RS07250 (SE858_07250) | - | 1408807..1410183 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| SE858_RS07255 (SE858_07255) | - | 1410280..1410933 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| SE858_RS07260 (SE858_07260) | - | 1410930..1412249 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| SE858_RS07265 (SE858_07265) | - | 1412301..1412948 (-) | 648 | Protein_1356 | IS3 family transposase | - |
| SE858_RS07270 (SE858_07270) | - | 1413126..1413326 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| SE858_RS07275 (SE858_07275) | prx | 1413368..1413556 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=902309 SE858_RS07275 WP_000027835.1 1413368..1413556(+) (prx) [Streptococcus agalactiae strain SagR92]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=902309 SE858_RS07275 WP_000027835.1 1413368..1413556(+) (prx) [Streptococcus agalactiae strain SagR92]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |